SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|180700 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|180700
Domain Number 1 Region: 27-53,117-348
Classification Level Classification E-value
Superfamily Kelch motif 1.15e-27
Family Kelch motif 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|180700
Sequence length 1398
Sequence
MQVLPDQEYLESAMQIENINYEHKHTEPYARTGHVSCYVDNYMFIWGGYSEKQILNSDNN
RITRICQYMNPYKFWKYLPDIKLWKSCNLKGQILESSGSGAVYDPKFRKLYIIFGCGSTK
YINSIFEISVDKKSCQFVDQKRVDNRLPAGRDKFSCCLYDRKIYIFGGHGRDITEQLHSA
RVDEFVPNWVDDEETPTGWNNQLLEFNLTDNSWKGSKPSPRAAHSIALIENTKHAYLFGG
RLQLNRLNDLYHLDLHTFIWTKIDVEGSVPCGRSWHTLNAFTNVPNHFKNGNTDNNNADD
DIWTINIPEYRDRPVKWCKKNEGLPSGGRLWHTTVVSGNGDVLIFGGCNNDIHDGQDIPK
YISNLVCLRFFPDKLYRLALRHILKDKKIHKKSIHELPKTSSSYIQKIWKTEKIIKMQKE
SVISKITNVINREFDREIKNKELEIEKVEDNINSAIGLLDRLRMAMVLQHYGKIDETDVS
DPVNVDDSSSSTTTNTIHPTVKKFLGKTLLPNHSTNNYNDNQNSYEDDHYSSNNINNNNN
VIGTINSFNVNKSSYTSNTAVFHNRRRRGDLFSVYKRLIIGNVSRYLLAKSKQQQQQRRS
NATSPTAPSSEASNNTTSPTHQWMVYVRSCSDDSTFVEDCVDNVVFKLHSSYKPHDLVKI
TNPPFRLVRKGWGEFPVRVEVHFKPPFDRTALNFVHQLKLDSTFTGLQIPGLETVIDVEL
KNMPMVKLLSADGGDDCDVDDDDDDAGDADGGDDVDMEKEEMTSTAPVATAVTTTTRMTL
TTTSSSTPTLTLHSPPSPPPPSTTATLLRITSTILKPSIPITTTTTSITTTSITTTTTTT
SSSSSLIITSTSLTSTHQILHNNNNNINNNINNNNINNINNNNINNNINNNINNNNINNI
NNNNINNNINNNINNNNINNINNNNINNNNINNKNIITKSVPYTTKSIVILSNLKHGITA
PPKIKIPNSNTFTNFTSSSVTSSSSLLSLAKSPSLTSLYKEQQQHRQQTQQLQQHSIRLQ
QCQPIKICNNHNNNNINKMININNNNVNKMININNNNVNKMININVNNNINKIININNNK
MINNNNMSNNIININNINNNTNKPLISMNPKSRPIKMTSILKCSQQSADSKMSVDQLLMS
IVLRCPIITADCDKYPYLSTSCLKKYLSWSVGKRRAYELCRASVVKNCLLFVLQKRRHNN
NNNNDVTTNNNDNEFISKYSNWFVAKWCRMYGHTPIDNDDDGEEDNNNNNNKMTSPLKEK
ISLVREIMPLSLEASYVQQCMSQICLRLKPVAVDENINPRFYANVVEEVLAGALKMFLVD
LLSQSHASKFANLTNENGDDDDNNNDNNNNNNNNDDDDDARILKIRPANVYKSSMYKDDK
KNDIKFDIKIPITVYLVR
Download sequence
Identical sequences T1FG67
XP_009028253.1.102002 jgi|Helro1|180700

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]