SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|181146 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|181146
Domain Number 1 Region: 7-200
Classification Level Classification E-value
Superfamily vWA-like 2.39e-28
Family Ku80 subunit N-terminal domain 0.00031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|181146
Sequence length 278
Sequence
MLQMYQEAIAIVLDVGPSMTQNMYLVESLQLIKMILQRKLFSESKDEIMLILFGTRTSKN
QLFNGQEYRHITVEKPLMQVNFELIQYVQNIDAHYKGQSADFVDAVVVAMDELKRCTEGK
KIYSSKRIILLSNLMEKFNDDQLDDILASLKESHFEFNYIGTCLENWESESDKGKTHQQA
NGEVNAQKTGLEVIRRILDEVDGDYFSLKQLLPCLSFIQSRSVRPTAWKANLKIGSSLEI
PICLYTRHPAYIQHKISRSDNQGQPLVGYAYRLVIENN
Download sequence
Identical sequences T1FGP0
jgi|Helro1|181146 XP_009028673.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]