SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|181602 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|181602
Domain Number 1 Region: 381-507
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000385
Family Pentraxin (pentaxin) 0.076
Further Details:      
 
Domain Number 2 Region: 535-578
Classification Level Classification E-value
Superfamily ARM repeat 0.000000216
Family GUN4-associated domain 0.076
Further Details:      
 
Domain Number 3 Region: 1141-1246
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0000458
Family Rhodopsin-like 0.041
Further Details:      
 
Weak hits

Sequence:  jgi|Helro1|181602
Domain Number - Region: 628-721
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00541
Family Pentraxin (pentaxin) 0.015
Further Details:      
 
Domain Number - Region: 752-798
Classification Level Classification E-value
Superfamily Hormone receptor domain 0.0471
Family Hormone receptor domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|181602
Sequence length 1283
Sequence
MSKDHKWSTGDLRNMKIKPLVHLKQSTDAILKEKYLVCRYLPQGARDNDLQYDGDANGGD
ARLINTCYNNNNNNNNNNNNRRTSIRFDYSSLTKKHNNNNNLNACSSGKIRSLGGVKGDC
DDEGHYGYDSDYQQFENKENRLKYKDTKYPTKQKLLHQQQQHQQQQQQQQLLLKRQQEIA
LLYQQQQQHQLQQQSKHNGSKKGKSDEKILKEQNNMLQQSRQQHQPPQQQQQHILNLSNV
NLKGSKISQKSSISIPNLDAHGDTNNDTDREIEISLPTSDLSKLIKNLSYHSYDDFLDNL
RHQGIAIPKNNKHKQRNKQHRQRSSRSSSRSADFELTANHHSSYYYHPECKDEPTKYLCL
CGTAFTWSTKFCVANGVNSHFEFPTTNHSSAFHYALLTNQPFPPMTNFTIAFWVRVLDPN
HNGIVLSYGIRNDNSSIFTFRSGPTLSMKIFESNIVTSVQLDRQKWCHVVWTWVLWRNGT
AVWSLFVNAVQRASGPKTKITTSSSSSSSSSSSSSNKTSRRQKKPKRSLHNSGGADDGDE
DDDDGDEDEDDGDEDEDDGDEDEDDDDDEDEDDDDDDITVNDSNNNNDDDDDNNSDINNT
NLDNNENIITVDNKDNVANDANDVNKMEDDATEKATIAAGGVLVIGHSFVVINDQDAILK
MADENCCHFRGDLGFIHVWDYEFSFDEVTNLYKDCRLTMVGNAVQWSSFRSGTRGIRIKW
PTDIFDVTRCFSEEESTLTCNQYCNLVRGPKCAEEILSNILWSRTTADSYVKASCDSFSH
DVANDSHTRYIRRHCTRTSDNRGKWMSPVLNDCLSKPYLDIDIQQQQQQQQQQQQLQQLQ
QQHGEKLEAELKLILNMLNSLRHKTQPDNIMDISTLIKSVCNLIEFQNAALIKLLKLYYN
NNNNNNKDDNTKFPPDFIRKLDMFGISRKQDRMVYPTISDSDQFIKNISSTLDGLLQPEN
IWLWLNSNPPGSEPDALLVTLEHLADLVANSLHFHLARGDLVIKDKESYVNVTFSRFEMK
VGMFKRNRLNETYIPTWLENRVWSRDSNFSVSLEPSQFHSRHNPHSNLVDFTERSEYEPY
TFGIVHVSNILNDNHHESTKWTWSAKECNLLLANVTHATCQCTGEGFYGLLSDLFDINYV
PPEADLTFVTYPSYIGSLGSVAFCGYTLILLIYYKSRTKATATHRHLAVTIIAQHLVFLF
GTEQIKIKIVCILSAVFQHFLTLSSFCWLMNEAFNLYIVITYSAHSRADEDENEGGNMIK
YYVLHCLESSVVPGGSSLYCSYR
Download sequence
Identical sequences T1FH58
jgi|Helro1|181602 XP_009029642.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]