SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|181899 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|181899
Domain Number 1 Region: 68-118
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000061
Family EGF-type module 0.032
Further Details:      
 
Domain Number 2 Region: 9-134
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000188
Family Growth factor receptor domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|181899
Sequence length 381
Sequence
MRVRVDSGFKCSNINTCNYNNGGCAQMCSNSVCSCYTGYKLQNDNATCKYEDPNTGATIN
TTTDTISCNVLDGLCGYACVRGVNGQPDRCVCRSGYELSPNGRTCLDIDECARGLTNCTA
PRVCLNFAGNYSCIAIIFKATKAILVIDPIFNALTITPEQPYSEEAISRIETGLNQIKTG
SGQLQTSFYALLAWTIVIALAIAILSAVIFKMPTADKTKASRSDASSVASVATQSNNTRQ
VLSGDNSLAPTRITSVSKALNSWNGTKYPGRPTLWDNKGSFGSSFSAHLDGVLGVSEIND
FNAEDGDNVDVVDHGLAPIHNNNINNNNIINNNNNNCNNNNDSNNKHLSSSSSSSSSTTS
SQSTSPAISQVVNEETLSERL
Download sequence
Identical sequences T1FHF9
jgi|Helro1|181899 XP_009029924.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]