SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|181924 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|181924
Domain Number 1 Region: 97-142
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000453
Family EGF-type module 0.012
Further Details:      
 
Domain Number 2 Region: 54-100
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000138
Family EGF-type module 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|181924
Sequence length 199
Sequence
MLNSYFYANNISKHTNNKTKRSYYKHFRNHNDNDDINNNDNSNNNKKHKRKKIHINPCEK
AICLNGGSCVWTVGEDYVYQCYCASGYYGANCEYSAAECMTHPCQHEGRCVRSKSVFGFK
CICTDGYYGSRCQKKRRKSVYNQMEEEEEARQLDRRRRKLENSGKYSATLAYVNVEFIAI
LIAMFILFILFLVILERDR
Download sequence
Identical sequences T1FHG6
jgi|Helro1|181924 XP_009029941.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]