SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|182201 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|182201
Domain Number 1 Region: 2192-2369
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.15e-18
Family Laminin G-like module 0.017
Further Details:      
 
Domain Number 2 Region: 1891-2048
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.06e-17
Family Laminin G-like module 0.0095
Further Details:      
 
Domain Number 3 Region: 1605-1628,1655-1784
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.74e-17
Family Laminin G-like module 0.018
Further Details:      
 
Domain Number 4 Region: 54-177,228-277
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000000112
Family Laminin G-like module 0.018
Further Details:      
 
Domain Number 5 Region: 1313-1509
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000000177
Family Beta-D-xylosidase C-terminal domain-like 0.07
Further Details:      
 
Domain Number 6 Region: 457-636
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000000693
Family Pentraxin (pentaxin) 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|182201
Sequence length 2589
Sequence
MGRGKNAIRAGKNLPIPHNTTTTAVATTTTTTFSQTRNVLLILLILTLHSPPSTSLHVDG
NDASHLIYPPWTTHCNANSSVRIDLKTTSTFPTNSTILLFYKDDIANGRIDYVEIYYNST
GYLVANVRDDKRRRATHGPVLLNDGKWHSVGLKVDNSRINLIFDGAMTQLFEFSPFHASK
VKESRTVIKDFNGIYKQCLIDDDSGYDQDNNVFYSGPYHHYRYNNRDRYLNYYGYSYIAG
LPPLLRRCPQLLSTPSALEHLSFRGYLRNVIFQNCTCSMTITHYDVTFDNNNADVIRYVT
ADKTGQDNYGRSTLRRTLYNTTEMQATLIVIELEKKLKEKKFPQNQISKSAQSDNNYHTS
SKMKDRINKFFSKDAIKNEALLLVENENYVIIQGLDLPNECFGNLALCGKGYTLSFWLNI
VKDCGGGSRCEGDSSQQQNRTLSDMEIITSSLLNNYNDNNENSNNNNSYFNNYYNNNYKV
DNDDSFYSIQDDEQTPAIDPSAENHQKFKIIWKPKKEVLTITMTSSHNINKSITLESGTF
IRHLWQHVTLTWNPSGVLRLYIDGQVDKELKIEPPQRVKKQRASQSADADIWDAFVIGRR
IKSRDSRSDNEDFSGREFLIDELKYWSVEVEEGEIAEKGPAFCSLVTKKSQPPPAASSSL
SPSTFNLKDLSHLESASSFKIIFISDIIEVSVTSLGHVLAGLKFDSSNVEVLSRDSLKSD
QWHFIETVQLFIDEKLQETSNEIKHLSSKNINRNNFGTIKIQDQPKFAPPSDGGGRVPTR
NNYGTFNGDRWRGLGGKTFVKSMRVCYGHREVLKKIGEVVASGKPQKLILDMDAIDSHNS
LATNNDNFVATVTKETAIVPGKVDNALRLNVGQVVDVLPTINGSGEMCLINLQACKLGMY
ISMWLKFKETSSLSRYLIRNNDIEIYYKNDTDSKNVEYLTGRSRKSLMEVQSKFQNNSRR
SKRDVVSKMNKLYSEFKFKNKKWSANVNSLPLDTWIFLEISWNPKSALEVHIDKILINKT
YPIISQKKDSETLEPESKSLCFGCNKTSQQHSTTGSYGYSYKSEDTKLFLDEVELWFQDK
QSLQDFDRITRDSDVYHIVVQFTEPSNTPTTSSTFFSPPSSSPSETSSTFYQITDNKIYL
HPKLHGDAKLWKGIMIPSSGYGNLGSHNDLCFGNIKHCRHGFTISVFFKQIKYPQEDVFI
ISAPNYFVKLSKSPMNIVVGVKCAEKIWYAATSKDGILVNESNRVDVSWSEDRGLLVFVN
KILKAKEFGGKNKDIYIGNATPLRRGSYHLGDPYLLIDQLDFWFASRNLIIGFHFMDDDI
SGFKLDMEKIEKDMIFHQSHTASVHNSPKVVAGYQGNGLLLNGLNQYLDLGRDVICKSDL
DNCIRGITVKFKVKPFLLLDLTYFVASPLVEVYYERGNLICLVRNKTKQWTVMSPKFKLG
SWNNIEITWHPLKGASLYINNTKVGQNSNPTTNEFDYQRSRRYLIGHADTSMKYEYYANA
IFDDVEFWEGDKESLEKVGDFSKERSSGGDDAEDDEDISRLTDNKNQKKQQPTTSRSGKN
LDKKQQNKSLQHFTSFPSGHSHLHQVPSQNPRYLGSHQQVYRPFHRRMLTFDGHSYIQYD
LNYENLLKIYNIQNNDDKAVVDRNRGNYNNEDNYEEVAIKLKATDQNGLIYFSGSAKNHV
YLCVKGGKLLLVVNYGELVPEKFKGHDDHHVKYDTQAWHEVTVTRVDRSIKINVDGLIHA
VMLKNNTKLLKHGELYIGGHYKLEDIMNRQLRNNFRGSIDSLTYRNSIFMRKIDFIEAVF
IKPSLDFLRVRGNAVMGMSPSREAANVNAITLFGNEFLRLPKWETKFIASDHIEVDKTVN
NHNREFNKKQKNIILEPSGSKKVSNFQTIPFIELNFKTFVQDSLLLYSGGSPGYSDFLVL
EISEGYLFAIYDSGLFRASRIKLGLNKVSVDSDEFRKENQSSIFVSDGAGHFVKIELVGA
MMRLTLDNSSRSYTLLKKLNPFHHLGTFTYLGGVDNINRLPWHVWNREAIDNKFPFFHGC
IWGVRLSGGKKTPKFNVTTPPMIQMAHHSTTNDEQNEYSSGISSQYDAIQDDEDYEMKRD
DDTLQHEQNFSKNKKSSNEIENVSKNAIVTNVNNIGSSRSSSDTGSKSDNLYDEVGDFEL
PIDLYRLAINQGLTKALNGCEIVPSRCVHNKCNAGKCLDRTEDFECDCSKTSYSGSRCEK
EAVKIALAGENFVYFRSSTTNSRHLSKISLRFKTTEKDGMIFKTKADRSDNFIETILKDG
KLYVEAKFGEHMRLFRHSYRCLERSTNTTAKTEQTKLNDNNWHDVTLVKKADWLFVQIDR
CLPDEAQLQGEGYSLEVDEIIIGGYKIPETPADATPPVTPPKPHSHQKVHATAQHHHAAN
QRTAKRRLDFRSHNTFGYFIGYIGSFVFDGQFLFDSFGVDSRIDINRQTSAFKLIEHNVK
TVHSEKILPIKPITLMNYVLKIPSNVINESNDIFAISFLFRFSDKFPTTKQTLLFFSGNS
SYFNDDNDDGDMESIWLMVKIENDKLALSSYDGNKLEVGVVAYWSFLFLRLINLFGDKMK
FLAGIGEVV
Download sequence
Identical sequences T1FHX2
XP_009030755.1.102002 jgi|Helro1|182201

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]