SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|182265 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|182265
Domain Number 1 Region: 60-175
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000000000000183
Family Spermadhesin, CUB domain 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|182265
Sequence length 277
Sequence
MCSGIRTCSVSVTSSIFGSPCGLLGAFLVVQYICVRDIESECSHVAAGSRRSYTDRIIQF
KSQGYISTPGYPSPYKRYLNCDWLVTVQSEQSILIKIFDFELDVKKGKECSDIKDNINNN
NNDNNDNNISNRIIFKECGSIGYQTMLIDASSVRISFRSGSGSLRQQRGFLLYFEGNDVM
MGRVTCEDGFRRASYNENDHDDDDIIINNNNNFNNYNNKNNNNNNNNNNNNKYNKINGNN
NNNYYYELIEDSDDGDNFVTVCNGHGWMSRYDHCTGV
Download sequence
Identical sequences T1FI04
XP_009030813.1.102002 jgi|Helro1|182265

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]