SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|182497 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|182497
Domain Number 1 Region: 37-78
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000000124
Family Spermadhesin, CUB domain 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|182497
Sequence length 117
Sequence
MAVKHISELRDICLDEPTEPFHYPSIVYPSFLRATLLASPNYPRKYPSNVTCSVQVVVPQ
HHLLDVTLLDFELDIKRDGVCKANICDPKQICLFQKQLINVKLIINSIYKNEKKGFN
Download sequence
Identical sequences T1FI99
jgi|Helro1|182497 XP_009030997.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]