SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|182839 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|182839
Domain Number 1 Region: 168-225
Classification Level Classification E-value
Superfamily Integrin domains 0.0000000000732
Family Integrin domains 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|182839
Sequence length 255
Sequence
MSRAVCINELLCYLFNNSDKIDDAEFIYEIMDFYNCEDIRIAKKILTSDLDALNLEKDDK
IKPNSSGNSKKDKLKKAKFESILDEKLKKLEELFIEERNIFREIVNDAAINNSPKVERKQ
QSDCKTESSKQSDWSEIVKRKIKKSSNVQHVANVQHVANVQHVANINMLKTKKKTHNTNI
ANMKTDCDSGTARCYQFNCSLGELRPGQSFVIRIRSRLWNSTFVECGFFKRTKRTQIATH
KAQMQKRPLSEMEEQ
Download sequence
Identical sequences T1FIU4
XP_009031813.1.102002 jgi|Helro1|182839

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]