SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|182878 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|182878
Domain Number 1 Region: 2735-2948
Classification Level Classification E-value
Superfamily Fibronectin type III 3.37e-26
Family Fibronectin type III 0.0053
Further Details:      
 
Domain Number 2 Region: 789-820,847-989
Classification Level Classification E-value
Superfamily Fibronectin type III 3.35e-23
Family Fibronectin type III 0.0015
Further Details:      
 
Domain Number 3 Region: 1172-1299
Classification Level Classification E-value
Superfamily Fibronectin type III 8.21e-23
Family Fibronectin type III 0.0021
Further Details:      
 
Domain Number 4 Region: 1517-1699
Classification Level Classification E-value
Superfamily Fibronectin type III 9.37e-23
Family Fibronectin type III 0.0018
Further Details:      
 
Domain Number 5 Region: 995-1130
Classification Level Classification E-value
Superfamily Fibronectin type III 7.51e-22
Family Fibronectin type III 0.0036
Further Details:      
 
Domain Number 6 Region: 2582-2739
Classification Level Classification E-value
Superfamily Fibronectin type III 8.88e-22
Family Fibronectin type III 0.0021
Further Details:      
 
Domain Number 7 Region: 518-667
Classification Level Classification E-value
Superfamily Fibronectin type III 1.48e-18
Family Fibronectin type III 0.0066
Further Details:      
 
Domain Number 8 Region: 2382-2531
Classification Level Classification E-value
Superfamily Fibronectin type III 2.51e-18
Family Fibronectin type III 0.0029
Further Details:      
 
Domain Number 9 Region: 3041-3228
Classification Level Classification E-value
Superfamily Fibronectin type III 2.87e-17
Family Fibronectin type III 0.004
Further Details:      
 
Domain Number 10 Region: 2192-2225,2255-2337
Classification Level Classification E-value
Superfamily Fibronectin type III 3.07e-17
Family Fibronectin type III 0.0076
Further Details:      
 
Domain Number 11 Region: 1803-1843,1877-1972
Classification Level Classification E-value
Superfamily Fibronectin type III 1.1e-16
Family Fibronectin type III 0.0053
Further Details:      
 
Domain Number 12 Region: 2057-2169
Classification Level Classification E-value
Superfamily Fibronectin type III 1.69e-16
Family Fibronectin type III 0.0029
Further Details:      
 
Domain Number 13 Region: 1647-1794
Classification Level Classification E-value
Superfamily Fibronectin type III 6.73e-16
Family Fibronectin type III 0.0043
Further Details:      
 
Domain Number 14 Region: 2955-3086
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000839
Family Fibronectin type III 0.0064
Further Details:      
 
Domain Number 15 Region: 353-423,475-507
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000469
Family Fibronectin type III 0.0069
Further Details:      
 
Domain Number 16 Region: 670-737
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000546
Family Fibronectin type III 0.0059
Further Details:      
 
Domain Number 17 Region: 32-217
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000435
Family Laminin G-like module 0.022
Further Details:      
 
Domain Number 18 Region: 1304-1451
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000228
Family Fibronectin type III 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|182878
Sequence length 3613
Sequence
MTQFPPLEEQWTALDFKMLSDWSTNVQSRWLGCRTNQDNGIRFMGTGYLTFKIDNLNDQV
LLSDINFSMRTQSRDGLIIFARGGIGTYYIAYMRDGQLNWDLSINGFVSSTMTITIDDLQ
RTSPLVNSGAPFRGGSFIVSSFVYLGGISSQAEAGMDDYLEQNGLSGLKKLLVIFNATSD
FSGCINSGIRLANSNGQMLKIGKIADASDVDLTGCPNIVRSSSAAPPTSSLSPPASSSSC
FAIADRFTVVYNSSSSSNIYNNNNNSNNNYGNNNNNNNGGSPILSFVDNGLDLFTDSTPA
LTTTEKSHPIIELPRIEAVQNVTYNYFAKKYGIVKSPTSINEINSNKSIRTLKKYTYQVE
AYNEAGLVESAWTLGRTLEGAPQTVPALQYSKTPRAGSIIFSWPPHTLQYYTGSIQKYYI
RFYCYSNDTNSTTSSSSSSSDSGNSSSSSSSNGGSSNDRNNLPGYVSPCSFNQTELRGTE
TGVTVTWLIPYTTYDVRLVACTSGGCKEGDGIIISTDPDAPAELQPPYVITSTPTSILIG
WNYPRYMNGEFLGFTLNLRNVQVYTSYTFSLLACNTFKCTQSDDVFLMTSEMPPSLVLAP
NVTIMDAKKIKIDWSRPSQSNGLITEHHLFLSMIGGKLGDLVYNGKDPNVYVTYLNKLTP
DLSYFLTLEVNVTWLPPENPNGVILNYRISRNAISIINSSESGSRVIDNLQPWTKVSILL
VVCNSKGCGQSSEVTGYSLEGQPEGAIVLRVEEIDVATAAATVAATTTSSYSSNGNNTVV
NALLVKLVTKMLRVRWSPASKPNSLLTYSVYFTGTFHDFTGVNSPKDFKFKTVSTTRLTF
TTNSTLTSGSWISIGGFLANQLYRGYVNATNSVGYLLSDVVTVNTSSAEPDGVLPPLLTS
PSSSAILATWSGPLIPNSNEISLYQLQFRVAGAPDSSVVSIFPTTTLATSYMKSDLRPFT
SYSFRLVAINIHGSGFSDWSDLTTRQDVPTGFDAPVVLGVTSRSLTLAWHPPLATNGIIL
NYDLYINDTKYGEATGNVTSYNFVDLSPYTALNLSMRACTIAGCTEKRYQTKLATTLPDD
NVAIDSMTSPSPTSVLLTWKAPSRPNGVIMRYELWRKSNNNTSTSSSSSSSSSSQPTNET
ETETLIKTILPTESTVESGNGNSRTFVYLDESSGLLPYTVYRYKLVVVNHFSLAASDWLF
IRTMSARPSGLAAPYVVAENSTSVRVTWSEPKTPNGQLQRYVISADALLKVEVNNLTLRS
LTIGGLKPYTVYNVTVTACTDGGCTESLPFSCTTKPANPEGLNPPLARPISQNYISIYWG
PPTNQNGPIGRFELLRMTLDQPLIDNPIALGFWFSMYTGDLLTFDDLYNVTPYSTYIYKL
TYFNGFGLVSSLNSTNVTSYGGLPRSRPLITVTSLGYSKVKVGWVLPDVRGLQGRAENIS
IRVYKLDDDSNGIVNSTKYDVTTPTTTSTVAGIVISPATTTARPSYLQPPTTTPSTTTTS
AKLFLSPPSPKTPSLPPPSPPIPIRVVNVSLATSGNHTTNNNNPTYIIVDDLDPLTQYSV
ALTTVTYGGYNVESDTVEFTTGSGEVEAVTKEGQPDPISQPIIANLTPTSLTFKWHRPSK
PNGIITKYVIRMTSPENRVVLDTSPKSPSIIFSPVDGSFFYALKGLKPYTKYSFTMEACT
VIGCTASDVIDVVTLEDIPQDIRPPLVFVGKSANMTEVTWSPPAILNGILTEMGVERSES
GLPFLNVATYRPDEMPVFKDPIKPEKHYRYMIFYSTSAGRGYSPSFEIFVPTAVPTFIPE
VTNATVLNESSVFLSWSDADDDGNSSNNAGFSLTYNLIIINSLQNTVYVTKIFVPQQQTS
PSQSSSSSSSPSSSSSSLPSSTIVTGLQPYTDYQIRMQSCLTNVSRPSCGTGSAKRITTL
PSPPEQQPPPSLTPVSPTCVLVTWSSPLKPNGVILYYLVKRRLVMSGALDGDVPSQTTDR
MVIPTLPTRPMNATSAFTTASPTLQLQSNELLIAKMNSTTMQFYDQTPDVLPFTYYSYRV
ICVTRTGETASPYSSVLTLESKPQILDRPQVLRVTSTSASLCWTPAVRPNGLILKYYLEC
RFMQTVDVQNNASSSGVGTFNDSSTDFTVLVDVASTSLCANVSSLRPYSRYKFRVSAVNS
AGSIWSEYTTEYETEQSTPSGIEPPSFESIVGGKSVIVSWLKPKSPNGVIAYYKIELKNY
IDDAMSSPASSPSSPSSSSPASLPPSSVTNVVYQGLYQHFEVQSLQPYTRYAMRLYACTV
SGCTRSRWFQFRSAAAKPEIPPSIYKMPLSNSSFVSVSWEIPKNTNGPINRIDVLRSRIP
ISNENATKTYNNNNNNNNTYNNNNNGNLRKKRSADSNMTNEDFHVVHSEKVGDGVVLQLY
TYADADVQPYHRYTYIMQISNEAGTISSTPVAATTPQAPPTFVAPPTIQTIQSQYDKLLI
TWQDPAEPNGRITGYQLKRANQIAPWSIQSNSNKSFIDMQLKPSTLYKYAVAVCSEPGCT
WSNWTEIRTLDIAPIFVPIPTVTVVSSTELLANWSQASLMMSSVTNNSPIGSDDFNNVGV
GKIVKYEVRVNDSTIYSGLNTEFLISGLNPYATYAVSLIACTAGGCSESANNMATTDQAP
PEAMMPPDVVTSSSTSARITWSEPQKKNGIITSFEVKRNGSLVYLLSLQSRPQQPQQTWS
YIDSDLKAATTYTYVILAYNIKGYATSPTTTIATPPSSPVGVLPPILQAKSAFSILATWS
EPLVANGNIINYGLYMKEVLTSSSPSSMSSSTSPSSPRKVFTGLSTTFLIENLQPYTLYS
VSLEACTLIGCATSDVTTIRTNPAAPEILSPPSLTSFYNGLNSKPEVGVNAVWSNPARVN
GVIIQYMLYRRLFAENYDDSTGKLLIADSPLNFRDLDVDLRPFTHYQYRVVAVNEVGQVS
STWADVVSVEGAPTGLVGPIVKSVGSRNLTIKQSPPDQQNGVIRNYTAYLNGTPTASSIQ
SEFSVYNLNPGTNYDVHILLCNWMTCVATPTISVTTLTEVPRNLGRFRIFNVTSSTLDCD
WLGPEINNQGNLSYQLTYRPVCPQPYSNDINSRPINFSCQESSPLIGYQGDNLFTRLTNL
QPYTKYEIRLKCMNDAGWSDESAVFVAITEVDFPRYLFSHPPTIRLMKNTLNVDWSESFQ
PNAPIKSFVLFKNDLMEYSGTSLTYVDQLVDKNRTNVYRVTMVTQKGSVSSPDLIFNPYV
PDIIAVNKTADLSVTSRPQNVASLTPVYQETWFLVLMIILSVLLIVMIIIICLIICRRPK
YGRQIDYTKDGQLKVNKDNKRRWIKTSGFNKRGSTTESTNSLVYKVPLDGDTSGFSPNYS
PVTYRNNIYTGDVENNNNNNTNNNNNNNFDDDDDDDDDGGGEEGYDNDENKVYRMSPDCN
QWKVLEDLGYNRPASPSSQYGDDDDVNKNNNNNNNNNNYNKNFYYNQIQQRRNNNNNNNN
NNNNNNNNNNNNNNEFIRCTDGYKHHQRQVEDNCVSLADVLPENDSRNNFRGDDRDVIIV
DGDDDVDYGVWNKEVVNEDEDEEDDDDDVFNDDGDDGGYISMRRNKLPLNMLSQNKQKKR
ISNPQSFFPDSKV
Download sequence
Identical sequences T1FIW4
XP_009031847.1.102002 jgi|Helro1|182878

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]