SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|183049 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|183049
Domain Number 1 Region: 253-319
Classification Level Classification E-value
Superfamily vWA-like 0.000000627
Family Integrin A (or I) domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|183049
Sequence length 1175
Sequence
MPKPVGYYSYSKEDVGTLSGDVQNWAMMIQNYILQLANDGIKREYTQSLFDSANYTYEDK
DGDHLVQQVKASLGEYFLKKKKVAKALAEKVIELYDRQLLRNWTSGQSRLYTLNKSIYRD
SDIPSRFPDQLIFSPYFKQPVSFVSSTVKISDEVPRDDRETIDTVAWSAGLEDIFKKNSK
LDPQLRWQYFGSTAGLVRIYPGREWNTNFAGFYDDYDPRLRPWYIAATSGPKDVVVILDC
RWHEYRTEVLSCQAENMVQATLAHKKDLIAKIQKLKPGGTSEMERGFELAFDLLNGRTKT
GCQSIIVFVTDGLDTDGEDVRCGPGQYSRSGFTAGPICRYNWTKVWQMVDTRIIYQKKHN
DAEVSKEFTANNNNNNNDNDTTDKSRTTTTTTLNEENKYTRTANDPNYKHDIFLAPPTRI
FSYLTVEDGEEFPGRISCPHRGSFKKISTGVNLISQMFDYFDFLSSNSRTDEGLWTSPYL
DSWGLSLIVTRALPCISKVTGKVIGVVGVDATVEDIENFLNRHQWGSVYSFLMNTDGETI
FHPRLKASENLVADPIFIPIEQLEQDKEGNPKEFSKIVKDMKAGLTGSLIIPHSRPGRKK
GEYTAATFYYAALDDSEFAFAFSLSDTDKVFRRAQQPKNLDTYDKSFFNLLIEYNSTLGR
SELKGVFDYLQVKENEKRFPGLRVSYLHSSIFLSPKCHCDPNSYFYDDDLARKTVDAHLY
INNQTGDDGCDKGGRYVKGLRADVFISQPVEKLWRTRSFDGIEDVKWTYVAMRSGVFRTY
PAHRSRRNYDPTSRDWYKRANKAPSKTAISTAYPDSAGVGKIITLSRALFEGMTSRTTEE
CLTISTVGPWPGGCVCQKDEDCVSAQCYLSVAPGPNKDLPRCATERVEAVTSLDILYKRF
HEITMALMQASNGKRSCGQTYLCPDGEEVCETRCYLFDDRANMITDPDFLTANDLDERKY
KGVTMGKKEGEIMKELIYKHGFFQRKESLDFQDVCSISPYAPKVTLEGIPQTPEELDNYY
KNKGPIPKFTNEYGCITDVVEYFVMESALGPSGVISGNVSGPCMSGYYHVTALPKTNLFL
LVIENWKQYKDTFFFNFNCKITQSIVNSGSYRIINGTCAHTDIARSTLAQMGKCPMLRNV
NITCRYNRDVSVKYSRIVAPLKNIGTVYLMSVLYF
Download sequence
Identical sequences T1FJ39
jgi|Helro1|183049 XP_009032011.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]