SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|183201 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|183201
Domain Number 1 Region: 55-103
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000195
Family EGF-type module 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|183201
Sequence length 280
Sequence
MSKHMKMKPQYNSKPSHQKKVKDFLMEKHLRAVHVMEPGVRNNYADHLDNSVTLYKCGVE
HYKFCGMNGICYYYSNDSNGPIRTCQCNGGFFGDNCEFTWYYAKHFDRSAQLTLLLSVVG
LIFAITILLALLFVIWRVWRIRKSRLEKQKLVACSLDDDINNINNELDKLTHEEKLVTTT
RAALVTFPGPSKTFMKTGSVSGNRFQTAAKTTRLSSIKEKPYGQSYRRFSAPTLFDPALP
ESQKLEKLASVMGRMSRLASKTGARGDQHGGDDCMVFVSL
Download sequence
Identical sequences T1FJA6
jgi|Helro1|183201 XP_009010483.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]