SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|183411 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|183411
Domain Number 1 Region: 37-133
Classification Level Classification E-value
Superfamily vWA-like 4.28e-16
Family Integrin A (or I) domain 0.008
Further Details:      
 
Domain Number 2 Region: 126-220
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000123
Family Growth factor receptor domain 0.0065
Further Details:      
 
Domain Number 3 Region: 185-292
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000157
Family Growth factor receptor domain 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|183411
Sequence length 315
Sequence
MSFNVLCVYSNDSYSDTCQHIIAYKSRKDIRTNTNRHTVATGCQMKDLAILMDTSGSFAT
GQQISPFRAMRRFAKNLIGRLDSGWDSEALVHFSEKAEVVFNFTTFSTKEEMYQAIDNIL
QFNENTDIAMGLRCSRCNSGYNLDNNGNCVAQCNVPNCQQCQALNRCSQCNSGYSLDSNG
LCVPQCIVPNCQQCQTPNKCSQCNGGYNLDSNGNCVSQCNIPNCQQCQSPDRCSQCRSGY
SLDANGNCVVQCNVANCFLCNTPNVCAVCNTGFTLNIQNNRCDVVNSYFQCKQHSATFQI
VKPVRHPTDVLNVTV
Download sequence
Identical sequences T1FJL3
jgi|Helro1|183411 XP_009010691.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]