SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|183747 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|183747
Domain Number 1 Region: 1497-1667
Classification Level Classification E-value
Superfamily vWA-like 1.08e-23
Family Integrin A (or I) domain 0.029
Further Details:      
 
Domain Number 2 Region: 1688-1801
Classification Level Classification E-value
Superfamily vWA-like 3.41e-22
Family Integrin A (or I) domain 0.002
Further Details:      
 
Domain Number 3 Region: 77-187
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000715
Family Growth factor receptor domain 0.0055
Further Details:      
 
Domain Number 4 Region: 586-686
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000275
Family Growth factor receptor domain 0.0044
Further Details:      
 
Domain Number 5 Region: 755-857
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000334
Family Growth factor receptor domain 0.0086
Further Details:      
 
Domain Number 6 Region: 238-351
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000419
Family Growth factor receptor domain 0.0069
Further Details:      
 
Domain Number 7 Region: 1379-1492,1666-1707
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000565
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 8 Region: 955-1068
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000763
Family Growth factor receptor domain 0.0062
Further Details:      
 
Domain Number 9 Region: 819-922
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000885
Family Growth factor receptor domain 0.0068
Further Details:      
 
Domain Number 10 Region: 1129-1263
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000241
Family Growth factor receptor domain 0.0039
Further Details:      
 
Domain Number 11 Region: 383-517
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000275
Family Growth factor receptor domain 0.0041
Further Details:      
 
Domain Number 12 Region: 485-588
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000331
Family Growth factor receptor domain 0.0065
Further Details:      
 
Domain Number 13 Region: 1262-1367
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000055
Family Growth factor receptor domain 0.003
Further Details:      
 
Domain Number 14 Region: 685-789
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000331
Family Growth factor receptor domain 0.0043
Further Details:      
 
Weak hits

Sequence:  jgi|Helro1|183747
Domain Number - Region: 179-243
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00732
Family Growth factor receptor domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|183747
Sequence length 1805
Sequence
MRPLENPHWTSKEVSTHRMRTADIGAVLILLNVLNPIQHNATFSFASNAKHRTDVPSVTV
ATIWIVMQTAFVTIPVSCNVANCKSCLVANVCIQCNDGYTLDTNNNVCRIQCNIGNCLTC
NSPNVCAICIVGYTLNAANNRCDVQCSVPNCQNCQSPNRCSQCNSGYNLDGNGNCIVQCN
VGNCFLCGTPNVCAICNNGYTLNAANNRCDVQCNVPNCQNCQSPNRCSQCNSGYNLDNSG
NCVPAPIPCNVANCRSCSVANVCYQCNDGYNLDTNNNICRIQCNVANCLSCNTPNVCAVC
STGYNLNAANNRCNVQCNVPNCQNCQTPNRCSQCNSGYNLDSNGNCILQCNVANCFSCNT
PNACAVCNSGYILNSANNRCDVQCNVPNCQFCQSPNQCSQCNSGYNLNNGNCSPQCNVQF
CQQCQTPNRCSACNSGYNLDGSGNCVPQCNLENCQQCSTPNRCSNCANGFVLNNDGTCRL
APIPCNVANCRTCFVANVCYQCNDGYTLDTNNNVCRIQCNVVNCLSCNTPNVCAFCNSGY
NLNVANNRCDVQCNVANCFSCNAPNVCAVCNNGYTLNTANNRCDVQCNVPNCQFCLSPNQ
CSQCNSGYNPNNGNCSPQCNVQFCQQCQTPNRCSACNSGYNLDGSGNCILQCNVPNCQNC
QTPNRCSQCNSGYILDGNGNCVVQCNVANCLSCNTPNVCAVCNNGYTLNAANNRCDVQCN
VPNCQFCQSPNQCSQCNSGYNPNNGNCSPQCNVQFCQQCQTPNRCSACNSGYNLDGSGNC
VLQCNVENCRQCSSPNRCSDCASGFVLSSGGTCRAEQISCNVVNCRTCLSSNVCYQCIDG
YTLDAINNLCRIQCNIGNCFLCNTPNVCAVCNTGYNLNVANNKCDVQCNVPNCQFCQSPD
RCSQCNSGYNLGNNGNCILQCNVADCYACTAPNVCRLCNSGFTLNSASNRCDAQCNVPNC
QSCQPPNRCSQCNSGYNLDSSGNCVVQCNVPNCQQCQSPNRCSQCNGGYNLDSNGNCVVA
PIPCNVANCRTCFVANVCYQCNDGYTLDTNNNVCRIQCNVGNCFLCNTPNVCAVCNSGYN
LNVPSNRCDVQCNFANCQNCQSPNRCSQCNSDYNLDNSGNCVAQCNVQFCQQCQTPNRCS
ACNSGYNLDGSGNCVPQCNVPNCQQCSTPNRCSSCVNGFELSGGGTCRAAQIPCNVANCR
TCLVANVCYQCTDGYTLDTNNNACRIQCSVANCFACNTPNVCSVCNSGFSLNVPNNRCDV
LCNVPNCQYCQTPNRCSQCNSGYNTDNSGNCILQCNVANCLSCNTPNVCAVCSNGYTLNS
ANNRCDVQCNVQNCQYCQSPSRCFQCNAGYSLDNNGDCVSQCNVQYCQQCQTPNRCSSCI
SGYNLDGNGYCVPQCGILNCIQCLTPNRCSACNSGYYVDSNANCSHCPLSNCDRCLSATV
CDSCRSGYEWSTLVQPPSCIPCNLPNCLDCTSLNQCRTCNPGYFWYPPYQACTRMVERQK
YADILNFLSNMVLSLPLSNNQIRVSVMTYSDFPVFNIPFTASPNLTVVANQIRNLPYVGQ
YADLGAALKQLYNVTILNSLRPSPVLAVAVVVTNGVSNDRNSSLSEAMLVKSQSRFIVST
LTVASFKDDYVLSQIASYPYWLNTFQVSVASNLTAVQKPLTEFTCNSKNECQLGNPCRNG
RCEDRINSYECICNPGWGGKNCDTVRCASSGDIVFVLDSSGSVENDYFLLVIQFVQNVIS
QLDIATSQNDNTGIQVGLIVYSTSPRVIFYLNTYHSKNRLVEAVNVPFMSGATNTADAIR
YKMRY
Download sequence
Identical sequences T1FK48
jgi|Helro1|183747 XP_009011577.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]