SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|183748 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|183748
Domain Number 1 Region: 29-196
Classification Level Classification E-value
Superfamily vWA-like 2.05e-37
Family Integrin A (or I) domain 0.001
Further Details:      
 
Domain Number 2 Region: 1946-2066
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000265
Family Growth factor receptor domain 0.006
Further Details:      
 
Domain Number 3 Region: 1776-1894
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000375
Family Growth factor receptor domain 0.006
Further Details:      
 
Domain Number 4 Region: 256-353
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000012
Family Growth factor receptor domain 0.0027
Further Details:      
 
Domain Number 5 Region: 1416-1528
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000209
Family Growth factor receptor domain 0.0066
Further Details:      
 
Domain Number 6 Region: 1206-1325
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000266
Family Growth factor receptor domain 0.0053
Further Details:      
 
Domain Number 7 Region: 525-628
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000283
Family Growth factor receptor domain 0.0021
Further Details:      
 
Domain Number 8 Region: 930-1032
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000855
Family Growth factor receptor domain 0.0052
Further Details:      
 
Domain Number 9 Region: 626-728
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000133
Family Growth factor receptor domain 0.0027
Further Details:      
 
Domain Number 10 Region: 793-895
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000298
Family Growth factor receptor domain 0.003
Further Details:      
 
Domain Number 11 Region: 1098-1247
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000428
Family Growth factor receptor domain 0.0065
Further Details:      
 
Domain Number 12 Region: 1332-1460
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000491
Family Growth factor receptor domain 0.0042
Further Details:      
 
Domain Number 13 Region: 1620-1784
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000824
Family Growth factor receptor domain 0.0047
Further Details:      
 
Domain Number 14 Region: 1553-1655
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000157
Family Growth factor receptor domain 0.0093
Further Details:      
 
Domain Number 15 Region: 727-828
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000184
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 16 Region: 352-459
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000414
Family Growth factor receptor domain 0.0077
Further Details:      
 
Domain Number 17 Region: 997-1100
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000214
Family Growth factor receptor domain 0.0075
Further Details:      
 
Domain Number 18 Region: 2039-2120
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000288
Family Growth factor receptor domain 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|183748
Sequence length 2122
Sequence
MTSLEQLVDRTLHRLSSRIVASGDQDFWYRDLLGFVSSVIKNFNVSPDGTRVAVVKFSNN
ANVPILLNSYTNISTLLPVIRNQTIEGGQTNIASGLRATRTDVYNTGRGYRPNVTNVAFL
ITDGESNIEVEQTIPEAINLKNLGVELFVMAVGTAVNMNELSKIASQPLPDHLFNAAQYP
SLDNFWKNVAKNICNAKGEPKVTTTAAPSTTTARPVGPCLVTNCLQCQTGTNNVCSYCAA
NYVNVNGLCVVQCNVANCLTCNAPNVCSVCNNGYTLNDANNRCEAQCIVPNCQSCQSPNR
CSRCNSGYNLDNNGNCVAQCNVPNCQQCQAPNRCSQCNSGYSLDSNGNCVPQCIVPNCQQ
CQTPNKCSQCNGGYNLDSNGNCVSQCNIPNCQQCQSPDRCSQCRSGYSLDANGNCVVQCN
VANCFLCNTPNVCAVCNTGFTLNIQNNRCDVVNSYFQCKQHSATFQIVKPVRHPTDVLNV
TVVTFWITVETAFLNATFQTVSNVSHLTDAPSVEVVTAWMPMEIVLCNVANCFACNPPNV
CAVCNSGYTLNAANNRCDIQCNVPNCQNCQTPNRCSQCNSGYNLDSNGNCITQCNVPNCQ
QCQSPDRCSQCRSGYSLDVNGNCVVQCNIANCLSCNTPNVCAVCNTGFTLNVVNNRCDVQ
CNVPNCQYCQSPNKCFQCNGGYNLDNNGNCVAQCNVPNCQQCQSPDRCSQCRSGYNLDSN
GLCVVQCNVANCFSCNTPNVCAVCNSGYTLNVTSNRCDVLCNIPNCQYCQSPNRCSQCNS
GYNLDGNGNCVLQCSVPNCQNCQSPNRCSQCNSGYSLDSSGNCVVQCNVANCFSCNTPNV
CAVCNTGYTLNAANNRCDAQCNVPNCQQCQSPNRCSQCNSGYNLDSNGNCILQCNVPNCQ
TCQSPNRCSQCNSGYNLDSNGNCITAPIPCNVANCRQCLFANVCNQCNDGYTLDSTNNVC
RLQCNIANCYACSSPNVCAVCSTGYTLNAANNRCDVQCNVPNCQNCQSPYRCSQCNSGYN
LDSNGNCIPQCNVANCLSCSTPNVCSVCNGGYTLNVPSNRCDVQCNVVNCVSCNTPNVCS
VCNQGFTLNVANNRCDVQCNVANCVSCNTPNVCAVCNTGYTLNAANNRCDDSKLIQLVII
LFSVQCNVPNCQTCQSPNRCSQCNSGYSLDSNEICIPQCNVQFCQQCQAPNRCSVCNSGY
YLDSNANCVQIPITCNVANCRSCLVANVCYLCNDGYTLDTNNNVCRIQCNIANCLTCNSP
NVCALCNNGYTLNVANNRCDVQCNVPNCQNCQSPNRCSQCNSGYNLDGSGNCVAQCNVQF
CQQCQTPNRCSICNSGYNLDGNGNCVLQCTVANCLSCSTPNVCAVCNNGYNLNVANNRCD
VQCNVPNCQNCQSPNRCSQCNSGYNLDGNGNCIPQCNVQFCQQCQAPNRCSVCNSGYYLD
SNANCVPIPVSCNVANCKSCLVANVCIQCNDGYTLDTNNNVCRIQCNIANCLTCNSPNVC
AICNIGYVLNAANNRCDAQCNVPNCQNCQSPNRCSICNIGYNLDGNGNCVLQCTVANCLS
CSTPNVCAVCNTGYTLNVANNRCDVQCNIANCVLCNTPNVCSICNQGFTLNAANNRCDVQ
CNVPNCQTCQSPNRCSQCNIGYNLDSSGNCVPQCNVPNCQNCQSPNRCSQCNSGYNLDVQ
CNVGNCFACSTPNVCAVCNNGYTLNVANNRCDVQCNVPNCQSCQSPNRCSQCNSGYNLDS
NGNCIPQCNVQFCQQCQAPNRCSVCNSGYYLDSNANCIPIPVSCNVANCKSCLVANVCIQ
CNDGYTLDTNNNVCRIQCNIANCLTCNSPNVCAICNVGYVLIAANNRCDVQCNVPNCQSC
QSPNRCSQCNSGYNLDSSGNCVVQCNVGNCFACSTPNVCSVCNNGYTLNVANNRCDAQCN
VQFCQQCQAPNRCSVCNSGYYLDSNANCIAIPVSCNVANCKSCLVANVCIQCNDGYTLDT
NNNVCRIQCNIANCLTCNSPNVCAICNVGYVLIAANNRCDVQCNVPNCQSCQSPNRCSQC
NSGYNLDSSGNCVVQCNVGNCFACSSPNVCSVCNNGYTLNVANNRCDAQCNVPNCQNCQS
PNRCSQCNSGYNLDGNGNCVRE
Download sequence
Identical sequences T1FK49
XP_009011578.1.102002 jgi|Helro1|183748

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]