SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|184118 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|184118
Domain Number 1 Region: 21-57
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000215
Family EGF-type module 0.023
Further Details:      
 
Weak hits

Sequence:  jgi|Helro1|184118
Domain Number - Region: 19-127
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000251
Family Growth factor receptor domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|184118
Sequence length 216
Sequence
MAIYKPSYMNYRDPTYDPSDANVDECATNTHKCTPPFGTCLNRVGSPVCRCSPGFERIGN
VRSGRDFIHISTNQYFVLQICELQTTITNANDANICNNVSSVCVNSVGLYGCTCLTGFYN
VDQLTCAVSQEKNVMIAFIVVSTVAILTTIGLIVYTVFLRRKLAVQNPNSIPPPIGATNT
LQPKNHDDALDVDMDVCSGTLEDRKLMNPTLIIIVI
Download sequence
Identical sequences T1FKM1
jgi|Helro1|184118 XP_009014072.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]