SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|184179 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|184179
Domain Number 1 Region: 178-259
Classification Level Classification E-value
Superfamily DEATH domain 0.0000118
Family Caspase recruitment domain, CARD 0.021
Further Details:      
 
Weak hits

Sequence:  jgi|Helro1|184179
Domain Number - Region: 124-197
Classification Level Classification E-value
Superfamily Tubulin nucleotide-binding domain-like 0.0961
Family Tubulin, GTPase domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|184179
Sequence length 262
Sequence
MDIDFNGKILINKINHLNANNNNVPKNNNSSSSSNRSNSDISNKSNHSNYNNNKSNNSNS
NKTILKSNKRFNPAASNNNNNSGDSVIRNESSKKTTTFNIPATSSHDKINGVNVYGISNK
YSKAANNNLNINNNTNHKDINNDFFFFNNNLNIGHKDINNNFFNKTPTVGPRLKSLKRNQ
LSIVLNTIPCNELFHWLVTNDVFTQKIVDNLQETYKTKRSINEAMIDLLIIYGEWAVLRF
SHALLFTGQKEMHQLLEDGAGL
Download sequence
Identical sequences T1FKQ4
XP_009015160.1.102002 jgi|Helro1|184179

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]