SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|184230 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|184230
Domain Number 1 Region: 126-199
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 0.0000000994
Family Pentapeptide repeats 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|184230
Sequence length 205
Sequence
MNSWFECDWCDTFRIYQLSCYWDLFACIEFKRLHALDPVTFAPLHLVLLHLVSLYLLLLH
LVRLHLVPLRLISLHLLPLHYLQLHLLPLHSLPIHLVSLPLIQLHLILLNFVLLYLATFG
LITIDAATFCPVIFDPATFSPETFCPASFDPVTFDPTTFDPAIFDHATFNPATFGATKFS
PATFGNALLCSATIFSATFDPAAQV
Download sequence
Identical sequences T1FKT2
jgi|Helro1|184230 XP_009017084.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]