SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|184499 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|184499
Domain Number 1 Region: 20-55
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000275
Family Spermadhesin, CUB domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|184499
Sequence length 187
Sequence
MSSSYNSLYSADYFNNNNYDDHEPVIIVSKSENLFVEFKSDGQLQGRGFKAVYRFLKDNS
NDNGDNNDDVSDDEANNNNNDNNNNYNINNFNFNPEEFFDNSDLRAIDRNKVYNNYYYNN
YNNDINVNSNNNSYNNNNNNNNNKYNGAIEKQQQQQQQRHIISDYLNIGNNNNNNNNNNK
SNDKSKC
Download sequence
Identical sequences T1FLC0
XP_009028424.1.102002 jgi|Helro1|184499

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]