SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|184605 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Helro1|184605
Domain Number - Region: 174-212
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0144
Family Spermadhesin, CUB domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|184605
Sequence length 473
Sequence
DKLLDAGSCQNNNNINNNIINNINNNNNNNIDNINNNINNISNINNINNISNIINNIKGA
NKQQQQQQQFNDVAYSLLIPTLQTNTYFSNLSPSPLSSASSTSFSSSSLSSSSSLSLAPP
SSSSSSWLSNEPSKSANKSSGNFNNGVSNSNNHDNNNNNNMKKFNNINNNINDNINDNNT
CHWLIRSDPGQRLEIILIAYYNSNNMTSSSLLSSSSSLASSSSMSPSSSSFTSPKNERNS
SHYDAPTEHSAPPESPEDFNSLNDGLFRCQRTKFLKIVTTTNFKINSTDNRDDKNNNSNN
NKNILNKNSKPIVNNSNNNNNSMDVYNKNLNGAEKLEGSNFGRNLTKTGKSWTNAKNVNT
AIQKNNNFNNNLNNKKSTSLLSSLVPSSSSSTPQIANEYRIKPKISEAEVRHQHQSPEVL
QICVNNDDSSSSPSAVRYLMSSGNDVHVTLTWRPGRPTSRYLLSVKVNSDMMK
Download sequence
Identical sequences T1FLK5
jgi|Helro1|184605 XP_009013190.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]