SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|184691 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Helro1|184691
Domain Number - Region: 63-88
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0196
Family Spermadhesin, CUB domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|184691
Sequence length 249
Sequence
MKSINNNCNTMTTIYVQHSQHGFLSPQHSRNQNFKSVNTPITTLPSNPNNNVNININNNH
SVNNNCGWSLVAEKDFRILLTIFYFTNPRINVDRSTVNKFDSDYFLFSSNKYTSSNNNNN
GEDASQDVIYKGVNISNNVFPSMPYIQHSNKSPSCLRRNFLLTRDRTSGREECASANMNR
RVREIFFSDSNHVDVIINFMLTSSSPGQAFNFLLKYQVSAISDWKLGSKSIADTKPKPMP
KCIADIISR
Download sequence
Identical sequences T1FLS3
XP_009016755.1.102002 jgi|Helro1|184691

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]