SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|184928 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|184928
Domain Number 1 Region: 33-249
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.78e-67
Family Lectin leg-like 0.0000198
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|184928
Sequence length 327
Sequence
MLLSFWSTIFCLVLSTILLIALVNSDANSNKNYLRKEHSLMKPYKDDRWNLLGSAMFLNN
YVRLTPDQQSRKGAVWNSVPCRTINWELHVHFKVHGAGTDLAGDGFAIWYVRDAMKLGPV
FGSIDNFYGLGIFFDTYSNYHEKHKHGFPYISVMVNNGSLHYDHDSDGTGTEVAGCEAHF
RNLKVETFIAIRYENNKLTISLDIDGKNTWRTCLKVDNILLPTGLFFGASAATGGLSDNH
DLITFKMYDVGTAEHEDEDEINGRMAIVPSLEGFEYEDFTKTEKVVKESWSFLFILFVIF
MVVVCLVLAAVGIYYFYESRQNKKRFY
Download sequence
Identical sequences T1FM62
jgi|Helro1|184928 XP_009015746.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]