SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|184962 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|184962
Domain Number 1 Region: 54-266
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.96e-65
Family Calnexin/calreticulin 0.000000238
Further Details:      
 
Domain Number 2 Region: 265-405
Classification Level Classification E-value
Superfamily P-domain of calnexin/calreticulin 7.19e-59
Family P-domain of calnexin/calreticulin 0.000000348
Further Details:      
 
Weak hits

Sequence:  jgi|Helro1|184962
Domain Number - Region: 407-451
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000206
Family Calnexin/calreticulin 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|184962
Sequence length 574
Sequence
MKKLPVLFLCLAFLYIYVNCEDSGEFEDEEEDVSEVESKQQEPDSPPREKPVYSPPVLST
PVYFADHFESPELFEKKWILSRSKKDDAESTISKYDGLWAVEEPKTSALKGDLALILKSK
AKHHAVSSALKRPFEFNDDPLVVQYEVKFEEGQECGGAYIKLLSKCNDNVDLSKFNDKSP
YTIMFGPDKCGNDHKLHFIFRHKNPLTGVYEEKHAKKPSANIDTYFSDKKTHLYTLVVKP
DNSYAIYVDQYEVSRGSLLEDFTPPVNPSKEIVDPDDKKPDDWDDRERIRDPDAVKPEDW
DETEPEMIDDVDATKPAGWLDDEPELIPDPAAEKPSDWDEDMDGEWEAPLINNPRCASAP
GCGAWKVPQIKNPKYKGKWEVPMIDNPNYKGKWSPRTIPNPDYFEDNQPFRMSPIGAIGL
ELWSMSNDIVFDNFIITTSKQTADEYAKQTWSIKHSEEASDSAGGFMQSVVDATHERPWL
WAVIVVVVVLPIVLIVAYCCLSSKGEDRKAGERKKMDARTADDEVDDDENEEYGEEAEGP
KEGGDSEYVGNYDSAEKKVTKRTKSDLESKPDQD
Download sequence
Identical sequences T1FM75
XP_009019390.1.102002 jgi|Helro1|184962

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]