SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|185095 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|185095
Domain Number 1 Region: 319-382
Classification Level Classification E-value
Superfamily Cysteine-rich domain 1.67e-16
Family TFIIH p44 subunit cysteine-rich domain 0.0024
Further Details:      
 
Domain Number 2 Region: 55-225
Classification Level Classification E-value
Superfamily vWA-like 0.00000000000000528
Family Integrin A (or I) domain 0.021
Further Details:      
 
Weak hits

Sequence:  jgi|Helro1|185095
Domain Number - Region: 278-308
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 0.0323
Family Transcriptional factor domain 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|185095
Sequence length 388
Sequence
MDEGNVGYAWEAEYEKTWEVLQEDEAGSLQSAVADIIQKAKRRQMMSRVGNVKIGMMRHL
LIVIDMTMAMLDQDLKPNRLFSTLKLLESFIEEFFDQNPISQVGLLAMKKRRCERIHNLT
GNSKKLLSCLNSLRKVNCEGEASLYNALDQALKVLKYLPSHVSREVLILFGSLSTVDPVD
LSCIIEQLKVHTIRCSIIGMSAGMHVCQKLCRETQGKYSVILDETHYKALLHEHLLPPVS
VAMQEISLVRMGFPQLETSALMKSIICMCHAGSGNVEDCIGKNGYICPQCGSKYCDLPVE
CTVCGLTLASSAHLARSYHHLFPLEAFEEVLAINIFKKNRFCHGCQRGLNEPNAYRCKKC
TYTFCTDCDIFIHESLHSCPGCSAKRNL
Download sequence
Identical sequences T1FME1
jgi|Helro1|185095 XP_009025823.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]