SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|185150 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|185150
Domain Number 1 Region: 315-536
Classification Level Classification E-value
Superfamily Kelch motif 8.24e-46
Family Kelch motif 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|185150
Sequence length 616
Sequence
MKMVCEIEESKSVDDVEDIVLISKTGGRFIVDAASFYQSSGYYRALKKSGMKDAQCKELK
FEYFTDNFLAEVEKYFSKVSSSNVDISDQLMKRLDEVEEELNGAFYLQINGLVDHYVLLV
LRYLNIKTWRHILDIAYKYALDSLSHKILDFVAKNFNNLQKHSELLTLTPNEMFYLVKSD
LVSASSEIDIFNFVVKWFFYDESRKPHAEKLLSEVRYSLMRTSDEKQCRGVIETLALRVC
LTKHEVKFRDTVDVLLAFGKRGQLSPLVTQILPVKELTRACKYRSMFRRMKSQRKNKSIA
PLVKFRCNEKKYFQGLYNFGSCVVNNCVYIAGGQYLESEYSAAVYSFNPIRNKWKPLSKM
PTQRASFYLGEINGSLYAVAGCRSDDGHRSVATSIVEKYIPEENRWYKLAPLPTAVYDLA
GCTYGGDLYVSGGNIIIDGVNRKAKELWMYDPTFEGWLAKAPMLTARGRHVMACFSNKLI
AIGGQSIFSNLFDGEIYDCETNQWTCILSLKKPVCSSTYAIVDNCLYLFSTGQNFFQRFN
LTKYLKVESDKNESPLLKDVLNQDKNKIFISDNLPKRYSSNIFDDDCKLYKFKASHKILA
SVSVIRLSKNYLRGFK
Download sequence
Identical sequences T1FMG2
XP_009029011.1.102002 jgi|Helro1|185150

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]