SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|185515 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|185515
Domain Number 1 Region: 138-241
Classification Level Classification E-value
Superfamily Immunoglobulin 9.68e-19
Family I set domains 0.031
Further Details:      
 
Domain Number 2 Region: 20-107
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000534
Family Growth factor receptor domain 0.0046
Further Details:      
 
Domain Number 3 Region: 94-137
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000103
Family Ovomucoid domain III-like 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|185515
Sequence length 252
Sequence
MKLICLWVFVCLFWAGSRAESCLSCNPEECLPVTDCVAGIIKDQCGCCDVCAKSEFELCD
HTRLPSLNMYGKCGEDLECTIRTDLNEGESQEAICYCKSQESVCGTDNFTYDNICQLRAS
AVVTKSGVTLAREGPCNTAPVIIVNPENVKNVSGSSISLSCEAKGFPIPVIEWTWTRVDK
QTVTLPSDDLHVSINMRGGPEKYHVSGWLQIIGLKKEHEGDYSCIAQNDFGFVKSSARVN
VVRSGDRFKGEF
Download sequence
Identical sequences T1FMX2
jgi|Helro1|185515 XP_009016644.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]