SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|185811 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|185811
Domain Number 1 Region: 259-416,463-507
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.18e-34
Family SPRY domain 0.014
Further Details:      
 
Domain Number 2 Region: 30-88
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000792
Family PHD domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|185811
Sequence length 545
Sequence
MEPIEAKVCTESAADDVPSAVGAGGSTLLPANPEDKTCYCGRDRNLNICEFQCGMCLRYY
HETCVSCYNRDCVPFMTNYQFFCKRCSMQESLMKRQASFGQMCLTAIANLMQKNKGKTMF
SKDADIIPYIETNWELLTSSPRRVKNTWHSSISKTMLKDPSIFTTKEGGADTTFGLVNED
LSKIGPNCESLLRLLCNRPVETKTQVQTEATRGRLAKRKTPGEHHYVVGSKQKKSEMTST
MRLAPSCYPAEHPFNKDGYRYHLAEPDPHAPNWQIFDESPEWAGKPIPGYLYRMNLEANV
LLSLNDRAPQLKVSDDRLTVTGEKGYSMIRANHGVNEGSWFYEVKIDDMPADSATRIGWS
QSLGNLQAPCGYDKFSYSWRSKKGTIFHQSRGKHYCDSGYREDDLLGFLIRLPRQADECH
LQLLPPQYKEKPLVKFKSHLYYEEKDLVAETESKLKPAAGSQIIMFLNGKCQGIAYEDIN
KGIYFPAISSYKNATVSVNFGPKFKYPPKDYQYRPMCQATEASAVQHALGDILYHVEHEG
QTLEI
Download sequence
Identical sequences T1FNB7
jgi|Helro1|185811 XP_009022297.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]