SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|186086 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|186086
Domain Number 1 Region: 281-566
Classification Level Classification E-value
Superfamily Kelch motif 2.75e-46
Family Kelch motif 0.0006
Further Details:      
 
Domain Number 2 Region: 16-130
Classification Level Classification E-value
Superfamily POZ domain 5.65e-29
Family BTB/POZ domain 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|186086
Sequence length 591
Sequence
MAERLDLVASKKWVYSTYGNVLVKSVRSLQANDELCDFTITADKKSIRVHKVILAATSEY
FRAMLRGYMKETKEDIVDLGGISASSLEMIVEFIYSGEMELNPDCLIDMLNAANHLQIPT
ALELCSDYIISLITFANAEEFVHIADIYSLEKVIDFFTDKVLTNFETFTEAPVFLSTSVS
PLMCYLQSDRLKIKSEVLLFDAILKWFRHDSARIESIPTLLRCIRYGLIPKTTLQSSHPI
FALFPDEAQLLQTGLKYHADYLKGHPEPDINWRIRTNETSLIIVIHGSSNRPLEIVAYEK
STSNFYLVGSDTNASRDCRVVEVENYLYIFRVVDSGGGAFVNCLIRFDPRHLTLIILLPG
RTIRLDPAIVVHGKKIFCIGGCMDVPQGIHGNTMLDTVEVYNLADNTWSFVSPIPDATHS
HAACAARNLIYYSGGIAASNRGAASPNFVQFNPQTEEYNYLCPMHSPRRLHEMEALNDHI
YVLGGIGSHSYDHKKNLIPIERYSIDTDQWTILSGTLAGRSIGHYVVVNDTIISLGREHI
SATEDAIWSYSPETDSWTPYTKIPHKTSLALSAGSFLNINFADEKVSKRKV
Download sequence
Identical sequences T1FNN0
XP_009028299.1.102002 jgi|Helro1|186086

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]