SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|186439 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|186439
Domain Number 1 Region: 153-266
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 6.55e-23
Family Synaptotagmin-like (S variant) 0.0079
Further Details:      
 
Domain Number 2 Region: 14-141
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.13e-19
Family Synaptotagmin-like (S variant) 0.043
Further Details:      
 
Domain Number 3 Region: 296-496
Classification Level Classification E-value
Superfamily vWA-like 0.00000000000000485
Family Integrin A (or I) domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|186439
Sequence length 552
Sequence
MAANKKAGGQQQASRISIYVSCQNLLNKDVTSKSDPCCVLFAPDHNLLWSEVGRTERIKN
CLNPQFSRAFEVDYYFEQVQKVRFMIYDIDSKAQNLSDDDFLGSFECTIGEAVSNSPMTR
PLSRKNDKRAGTSTITITVREMLIQPEVLSLNFKAKHLDKKDLMGKSDPFLVLHCIMPDG
SWQVVHKTEVIKNTLDPVWEQFDIRTNQLATINYDQPIKIECHDYDSDGSHDLIGSFTTT
VNEIMRATNGVEVEWQCVNPKKLSKKGYCNSGMIYLTAVRHYRDYSFLEYVFAGLQLNFS
VGVDFTASNGDPKEPGTLHYINPKKPNQYMKAIKAVGDVIQEYDSDQMYPALGFGARVPP
SKDVLHEFAINFNSSDPFCKGVQGILDAYQACLSKVQLYGPTNFAPIINHVARFALQTQQ
EQSARNYYILLILTDGAISDTDDTIKSLVYASTLPMSVIIVGVGLADFSTMNILDSDSKA
LADKDGVQARRDIVQFVPMRDFENSPAESLSKHVLGEIPKQVVEYFRMYTIPPGRGVVKP
LAPVSEAPPADH
Download sequence
Identical sequences T1FNZ6
jgi|Helro1|186439 XP_009019823.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]