SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|187786 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|187786
Domain Number 1 Region: 6-134
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.39e-26
Family Laminin G-like module 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|187786
Sequence length 168
Sequence
MLQNVIGDYVIMSLNDGYLCLVYNLGSGIFSLKSKFRMQRNIWHTVHLNRSQKSVEMVVD
SVDSTSVTSPGRFFELTLGKDHVIYVGGHPDIDSMPREVNVDEGFQGCIRNLKIGKEDIN
LSRSHVDGRNVAKCSDVCAGEACMRGRCLENADGWFSCLSDSTTNSND
Download sequence
Identical sequences T1FPD4
XP_009008779.1.102002 jgi|Helro1|187786

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]