SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|187878 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|187878
Domain Number 1 Region: 96-281
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.57e-19
Family Laminin G-like module 0.013
Further Details:      
 
Domain Number 2 Region: 9-52
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000164
Family EGF-type module 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|187878
Sequence length 302
Sequence
MDRENHLYSFIDECKVCSENACQHEGQCLPNHSEKGYTCRCQPGYTGAQCESSIPCLQGT
KCPWHMLPAIDPDHQCHEECLNGALCVAHEFHDFSCQCKIGFTGELCETSYDKMQGFEIM
RGGYISLEAKDIGTLINITNDTTWSFDLVTTDKNTLIFWHSNSEASIYQAVFIHQNGSIA
YKEKFERLEASCSVPVEVSDGILHHILFGRHQSRMFIEVDGSFRTERATDEVHPIQKHLG
HLIIGGGSHVKSYTQNTFEKVFEGHILNISVDGQAVNMSAPGVSGWNVNPSYHYQIDEAS
FD
Download sequence
Identical sequences T1FPG0
XP_009009174.1.102002 jgi|Helro1|187878

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]