SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|188065 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|188065
Domain Number 1 Region: 14-104
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 0.000000000000258
Family Reprolysin-like 0.0072
Further Details:      
 
Weak hits

Sequence:  jgi|Helro1|188065
Domain Number - Region: 164-221
Classification Level Classification E-value
Superfamily Kelch motif 0.0353
Family Kelch motif 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|188065
Sequence length 523
Sequence
MFAGNFDNGEPRFIQGLANIKAICTSQAVSISQENGEFGTTGTTSHELAHNLGSLHDVLS
DNSCDSKDQYIMSVAPGQLTPQTFMHPFYFSACSIDYMRQYLASEAVLVAIMRGCTVLGW
SERNCLLKTSLVQPATPSSNIPSNTPPGQQFPINVQCQLFFGMESYYCGGMIYDEKMCSL
LYCYDPLTSQCTTSTEYRAYTGTTCGNKKWCQQGSCVYDSAAPAASDVCLSGDTRDPLTK
CWELMANDFSKCYLNDYYKKCCATCEYFKKKNSTDASCIYGDKQPEYCKGLKPSSCYNNQ
DLKLCCQTCKNFWMTDMMNCEYGDRASWCSDPSQMKASNCYNSENTCCLQCAKFNLQLYG
CQYGDKIDCSFVTPDQCPSMADNCCIKCNPQYSSLAPSILKGINITLHSPPPLTKRFSNC
NDGRPWCNNLPPFSCYDSTLKNSCPCVCQQMRVSADSNGFEYGDKYTWCGNITKTECGNL
FSQGACSVSCLTAKDGSEHLTGSRKILLSFLIFSLRCFSQLLS
Download sequence
Identical sequences T1FPL5
XP_009009724.1.102002 jgi|Helro1|188065

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]