SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|188109 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|188109
Domain Number 1 Region: 194-312
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.89e-25
Family Spermadhesin, CUB domain 0.00076
Further Details:      
 
Domain Number 2 Region: 54-171
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000877
Family Spermadhesin, CUB domain 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|188109
Sequence length 353
Sequence
MTLSFERVKSMIEELTNVNIAVVCGLSLLVLLVDTSDDGGCDPPYRSKTHISFDGLEGHL
TVPVFTKTCTSDVKVVYTFEGVADQRVQLTLNNVSLGWDDTEHDTVNQCETGDFIKVHVF
VGRSKQELTNVCGNRTFLKFMSTDNTMELEYVKRSSTKILGPAFSANYKFVTNFGITTGI
QNKNQPNIKCMFEYFSSQGNNGTFSSPNYPGYYPRNTECHYIFHGSQHERIYISFKYFDV
EGHSNCKDGTQSDYVELSNFNIPLVDRKMDRLCGTDVVSKRKEISSDGNFFRVTFKSDDV
YDGEGFEAAYQFRKISSDQHMLPRGEKMVGRTSVLKSSYILLSISLLISPLHS
Download sequence
Identical sequences T1FPN3
jgi|Helro1|188109 XP_009009831.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]