SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|188262 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|188262
Domain Number 1 Region: 221-429
Classification Level Classification E-value
Superfamily vWA-like 5.49e-49
Family Integrin A (or I) domain 0.00077
Further Details:      
 
Domain Number 2 Region: 20-221
Classification Level Classification E-value
Superfamily vWA-like 8.48e-38
Family Integrin A (or I) domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|188262
Sequence length 453
Sequence
MRRYKRLILLIVILFTVKKELTEAQSCKDVKKQIMFLVDSSYSVCESNDIDHPDCNWNIM
KSFLKDVVALLPMQTRNLQVGITTFSTRINKQTNSSLTSDQNLLMTIIDQMPYVGGNTNI
SGALRYARSIFLNGMYSSNIDVKKVIVLITDGLSNVDSSLTLQEARLNKQLSIEQYAIGV
TKYMNEDELQDLVSDPVSYHYLNASDFSHLNLLINELLQRLTCSQPPLPEPCRDTRSDIA
FVLDSSGSIIIQHSDNSRDLSNWVLVKNVVINVAKNLNIGLSQTRISLITFSHIARVEFY
LKDFNDFESLAANISKIDIIGSETNTSGALRLMNDVVFNVKNGDRPDVPNVAIVMTDGQS
NVNYTGTVPEATRAKNSNTRIFVIGLTDEIYYKELQGIASLPWETHLFNRTSFSLADTIV
SNLVWNVCHSPCTHVENGSCNNGSITRCCQTRN
Download sequence
Identical sequences T1FPT4
XP_009015470.1.102002 jgi|Helro1|188262

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]