SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|188313 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|188313
Domain Number 1 Region: 245-320,353-585
Classification Level Classification E-value
Superfamily Kelch motif 1.1e-40
Family Kelch motif 0.014
Further Details:      
 
Domain Number 2 Region: 69-179
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.36e-23
Family Spermadhesin, CUB domain 0.0013
Further Details:      
 
Domain Number 3 Region: 1580-1846
Classification Level Classification E-value
Superfamily Kelch motif 6.8e-23
Family Kelch motif 0.011
Further Details:      
 
Domain Number 4 Region: 1173-1209
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000234
Family EGF-type module 0.013
Further Details:      
 
Domain Number 5 Region: 2385-2521
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000155
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 6 Region: 1250-1294
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000753
Family Laminin-type module 0.029
Further Details:      
 
Domain Number 7 Region: 1298-1347
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000502
Family Laminin-type module 0.0052
Further Details:      
 
Domain Number 8 Region: 2556-2590
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000614
Family Laminin-type module 0.016
Further Details:      
 
Weak hits

Sequence:  jgi|Helro1|188313
Domain Number - Region: 1415-1440,1468-1480
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0628
Family Spermadhesin, CUB domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|188313
Sequence length 3276
Sequence
MPRAGFYILIYIIYEGFKLTDNRQTNCSELQSLQVCDTKLCCFLCEWNSQDRDAQTVKKE
QVGNSSSSCSGRHVLNATSGVVSDGAGDYKQNMRCEWLIIAKPEHYIMLEFSLMSTECIY
DYLMVYDGNSYNSPVIATLSGVISPSPIIARSGYMLIFFLSDTNYGLEGFKAVYHVTRCP
FNCSNSGLCDEQTGACRCQQGFKGYACQLPLCPNMCGQSAHKGFCTEDGCRCSPGWHGDD
CGVHIPSYSPLTSSSSSSPLLGWSLFSRSDYVKRSGHTSVYVPLLEQLFLFGGFDFIAAS
NELIIYDLNTNSWRKIENDLDINSSSSSSPQPSSSSSSSSLPSSSAANAISWPAGRFDHT
MSLLAGRFFIIFGGAINSHDCLNDMWVFDVLDHKWTEVHFINEPFEKPPPLFGHAMVIVN
DKYIYVHGGKSNKGSVLSDVWRYDVSSIVQWFRNKSNKFPVLKWEKLPARGGILANHRLV
GHSMVYDPVSRFLVIFGGLTDDNSRFTKRVSNIVVYKVDENMWMDLNSTLDAPSVRAYHR
SVIVDRYMVVVGGNIHQHQVVEQCFDDAIYFLHLDCWKWTSRQPLNENVANASGSMTRRC
SHALAVIDDVIMVVGGFRGTLEDSVYAYVMPPTMFASHANSQFDDTLQNSSAPDGTALLT
TPSEVVDECSRYLTKTSCLSFMNCLWCLLVDDDAMGSNFEEEEEDEDEDPVGNHFQCLHV
KSSEHCKSRTVERPPCPGICPLLTSCQACTKVGSSARRNDLSGRTDGSCVWCVDDSLCVS
NGSTCSTRSANSWQADARTNLTTEDECLLHNKKRGLNWIKYNHPPNSLIPDQVSILNGST
CQFKFEVVTEQESSSLARGVLRGFIHPPFSKIQQPIMLSVYATNVPLIMYMNEVVDGLVP
KTKTKVAEINQTVYKSVNIPVPTPSALKDTKYLVEIDINKMDNNIRSPSAGATVSIKWNI
TNNLPRRNEVIQPDYLELYHSTGGEGCGEQISCLSCLTDHLCGWCAGSHTTVESCLRDDN
ECVWCESTNRCFRFAEYIPSFLYVGCRIWMGIDSRVSRPPCGSLTNCSSCLQERWCGWCG
LTKNFNVGLCLDGDFSGPYYATCDTNLLSQVVMNASRPSVFITSSSSTPSPSSSSPSSPF
SSSPSTSSSPSTSSPSTSSSPSSLTSTWSYSVCLDVDECELNTHSCHENASCINTYGSYR
CTCNKGFKGDGMLNCSRTCMEACVHGACSSATFTCVCDLGWTGPQCDVDCLCNKHSTCLE
GGVGVCDACQHNTIGSYCELCLPGYFGDVMSSQGCVECQCNMHGDMDEGTCNSTSGECYC
THHTTGKHCAACLSGFYGDPRNGGRCYQSCENKLIITNATSGGLGRMLGQQQLSQLQKPQ
HVFCVAIITPHNSTSLSSLLNKTSSSSSFFSVKDQRKVIELTIDIKNILCYKDFLYIYDG
IPEQFLLPSSATCSSSSSSPSPSFPSSSSSSAKLIASICDNMITSPAKYYIYSEYLVIFY
ESFHANGVLTTSALSSSFTGPTPSFSVGFNASFQVLPYQHAVADITVCQDELNKNLQAYS
LTYCGCSNDSSDDNGTTGVNGLYLFGGRTNEKVLNDLWFYEINARKVHPSEDAEANWLLL
DVECSTRPPARYMHAMVCIDGKLYLYGGVLGGPADDVDDDRASTDWNSEQSIYSNQLWEF
DLHTKLWSLIKLPTSSPLLSLPHLAGHTMTSINDDVIVVIGGVPVSEYIVYTYEIGRSHF
RGVQHLGYGVKGIYGHASAYHSMERTIFVHGGYQLNGSAFSTSNRLHALKVHAGSNGDVD
LDNDRNFRWWMFEEDGIQDLSMQWHDMILLDDYIFLIGGSFPSSRSSSSSSSSSLLTSST
SSSSSAFTQFLSMGHFTAVHLSNTVYGLARKYKADESVGVLVSLVVPTNYCQLVISEEDC
LKVNGCIFNYKLNDADKLCVCCDRGGGDDEDEDEDEDEDADENDLANADTNIKCIYSTTK
LRASSSSASYFSLFDDVIPDMSNLKCHKLKFDKHNCADYKSCKSCVLAIENCSWCHNCSQ
CIESSFDCQSTCSSKRPPLLTTITSSTLTSPSSSSSSSSSSSSSSSSSSSSLSPFPSLPF
LKLLNVSECYAYRNIHADERDDDDDDDDGDHDYDGDNCSGIENCEDCMHNKYCRWATSKC
NPLVSDKQDDSTGCPADRCVDRYSSRRPQKTTPSSPPFSGARKKLNTNQAQHGKQQQQRH
HNQNHQRPQQCFSRCYAQRNCKDCVLENCSWNTLNNVCMPTSQIDILCSFGQCGSLVTTN
YVSNDVSLQNVSSTCPSECSQNTLCDSCLSNPHCGWLPSKLSSYTGAGCCRQGGLGGPSS
SESCPRDEANDSVGYPLTQNSMSGAQSASSTTTTSTTLSEHLQWHYFSCPPENECLNGHH
NCNNMTQRCVDKLLGFECTCMDGYIFHDKLNTCVPYCPGGCVHGNCVRPNVCQCLFGYVG
LNCSYECKCNKHSQCKSETELNKCMQCLNNTMGLTCNKCKPLYVGDPVNGGRCRPCQEFC
NNHSRVCMSSEDFIQTIKYPALALDYENVTNWLKNGSSDEKSTKCLNCMHNTHGDRCEKC
SVGFFRIATQQRSEPCTRCQCNGHSDLCEPEKGDGCDCRNNTKSPRCSSSDPPEKCYLAQ
CSQCMDNFLGTPTNHHQCYRHFSTDSQYCFDPTSQMNCMPMKEPNPLLQFRTLFFAIQPR
TNNVNIRVYVDVTKGGVKVFLAPFDNAFQVFVDPITGAHSVKIDPQYKLVDLSNNVADRS
HKNNNGSDGGSSYNINNANDGDEEEDEESDDGLYDTRYSNDQTAGQEGSQKEALKLDDSD
QSDEDDDDVDHYERYHNDFDDTDDDSYELSFSNVVTLKNNLRKRKAATPASINTTPTFNS
SSSVKIKLNSKQKLHAQSNKKQNKSNQSSEKKQIKKTNRLTTTSTRSSTTKITNRLDIIS
STRATTTSTTKTASTSSQTAATLLLNVRDPQLLKYNFVKNVNNNKYYTLEKRTADKHVTY
VTLSQPDSFLIVDNVKDRLVVQIASNIYPLKATRFYMVILGNEPASYGGVYTRHDTSHID
LFVFFSVFFSCFFLFLAVCVLLWKAKQMYDAHTTRSQNLLEMEHMASRPSARIIVVMGDE
LDETSSSSTAEIRSTSSSSEQLMSNVSVPATLTTVLQKGSRKFFSHDSPMTIVTTTHKQD
SATAPNLETDVNKSKQQLHQMQQNSAKKLKKLRVCPVAMEYNHNNVACVATFLFELPGAN
SARVRACFGSCLVVPSSNSNINNNHPGSFHHSGVKI
Download sequence
Identical sequences T1FPV2
XP_009015645.1.102002 jgi|Helro1|188313

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]