SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|188530 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|188530
Domain Number 1 Region: 233-451
Classification Level Classification E-value
Superfamily YWTD domain 1.44e-25
Family YWTD domain 0.00045
Further Details:      
 
Domain Number 2 Region: 2-180
Classification Level Classification E-value
Superfamily YWTD domain 1.09e-21
Family YWTD domain 0.00047
Further Details:      
 
Domain Number 3 Region: 630-805
Classification Level Classification E-value
Superfamily NHL repeat 0.0000445
Family NHL repeat 0.027
Further Details:      
 
Weak hits

Sequence:  jgi|Helro1|188530
Domain Number - Region: 183-221
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0023
Family EGF-type module 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|188530
Sequence length 992
Sequence
MSGSVYWTDSSHNWIMVASSSAANVYKRLVYTKLDKPTGIAVHPHLGFLYWSSSGALPKI
ERSNLDGSNRIVFISKDLTEPQGVTIDYDNSLLYWVDGWTSLLQCADARTGQNMLSYFIQ
SPYFFFSALYDAAIYKGLILITDQLQCIILTNLTSRTFKLHPIKSYVPYDVVVISPDNQP
TYDFSTCASLNCPDICVSDGNGTYHCICREGSKMLEDNNTCVVYSRPDATNFIYSTDSQI
CLYDVLRSVASPECVISPESSLPSALAFNYYSSRLFVSDVESGSTYRMITDFDNPVNSLV
GTNKKKISGLSVDWLGDNLYQTDTEAGTISVSKLDGRYPVVLLKNLLRPWDIEVNPLSGL
MYWSSEGTVYVSNMDGTVVQTCFMLTAASLKGLSIDIQNNALYVADQSLPGIWMTSLDCD
SHKKVIQLDKNTKIDDVIIINDVLMWVNGTNIVGMAERVADSFNFLPSPVINDNVNQIVS
YGYNMQPMSSDSGDLLNPCVDFGGNSSCGQLCLLRPNQETTCACSAGFSLVHYTECVSDL
LSDDFLLLVDPISKEGYQIPLGNELQDDNDKTFYWLDVVQLDLPFYNDISSGATIKSKSV
DDRLREVNVLTIKKSIKPTKIDLISDIHTLIYDDDDSGHLHGYDLVGNLAWIFEDVEGLK
GGIYALNSRTMDFYWLDSRTSSIKKVRLSEYKRKFEDEIPTNDTDPNNLTATTTFDSTTE
TTSNVETLMHWSKDPIKGLSLSINSGEMLVIWTFNHIYICKESEVVLHKKFENTNLTSVL
FSDSIIYFTTWNENSVYRFDTNSKKLGNLFAGVFNRIVDMRGFQNEDQTWNVDQNSSKAG
KQRNDGLIAGLVVGFFLVLVLSVFAFFMWRRKRKTEIIERYYSTMVTEQEQQIVNENGTS
NENILDRQHGPYNYNQQKIDNSSYGTQTHQTIGGPSFVGGKGEQAVKGDLEDVRIVYDGD
SNKNGQDPIGRSGDEQSSRFAEIDITKLSSYA
Download sequence
Identical sequences T1FQ35
jgi|Helro1|188530 XP_009019364.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]