SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|188549 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|188549
Domain Number 1 Region: 336-619
Classification Level Classification E-value
Superfamily Kelch motif 7.72e-68
Family Kelch motif 0.00000332
Further Details:      
 
Domain Number 2 Region: 109-181
Classification Level Classification E-value
Superfamily POZ domain 8.63e-16
Family BTB/POZ domain 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|188549
Sequence length 643
Sequence
MFLNVKEPSGISVQDGKRPDGCTLTPWRAGKCLAWDVTVPGTLAERYVHLTSKECGLAAI
RASDEKIKKYEHALPSLDFLPIYIEVLGPMDPNTLKFIKTLCKMIGVRGYFKSMFLTDMS
ESRNGVVKLEDIDPDATLSLVQYAYTSQLLITVENVQPLLFASSILQIDSVSRTCCEFMA
SHLDETNCLEVLSFANHLGHKLLVNKAQIFIIRNFREISQIPELLKLSYKLFLPIICADD
LCVDREEDVYDVVIKWIKYDVVNNIKYIVPLLKNIRFTYFLPSTLVDIVSTEELIRTNLD
CRDLVDDAKDYCLFKANVIYGYKGVKKHRPRKIYSGVMFCVGGRGFDGNPFKSIECYDVY
NDRTIILLMKLKVVKYFFRNIFEKKHQSKLFAAGGHDGVTHLKSGEMFDPQTNTWTPIAD
MSKLRRGIALAYLNGSIYAVGGLDDHSCFPTVERYDIASDTWFEVKKMNYSRGGVALVSY
QSSLYAVGGNDGSLSLESCESYDSSANNWVVIEPMNKRRAGAGATELDGYIYVAGGFDDN
APLDSVERYNVADNQWTIITPMSRPRGGVGISSLAGKIFAVGGHDGHKYLDSVEEYDPEK
SEWSQVAKIGTCRAGAGVVTVLCSLSSLVDITNSISTSPGDII
Download sequence
Identical sequences T1FQ40
jgi|Helro1|188549 XP_009019408.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]