SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|188571 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|188571
Domain Number 1 Region: 70-125
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000735
Family Ovomucoid domain III-like 0.011
Further Details:      
 
Domain Number 2 Region: 6-61,148-208,238-266
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.000000131
Family LacY-like proton/sugar symporter 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|188571
Sequence length 284
Sequence
MVPSAASGLTSYVGGVVSGKLKPSLDFAVTKNMMITSVGSIVNIFVLLAIMFIQCPANNF
PHGYSESTKSVNLTSACNKNCSCLVDSFDPVCGVDNVWYLSPCHAGCSAHFSNSNGSMMF
SNCSCINGEQQTAEAGYCDNSCTFFLILYIIGLTLFCSVSNLYNVPITNVILKCVDEEDK
SLALGIQLILICLAMLPSPLIYGQLIDWTCILWKTSSCSDARGSCLAYDNSMLRLVMHGN
TLFWRFMAAVFYTISFLLSWRKFKKLELKNVDNSNDTKGKHVKN
Download sequence
Identical sequences T1FQ49
XP_009019496.1.102002 jgi|Helro1|188571

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]