SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|188638 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|188638
Domain Number 1 Region: 24-221
Classification Level Classification E-value
Superfamily vWA-like 7.57e-32
Family Integrin A (or I) domain 0.0026
Further Details:      
 
Domain Number 2 Region: 683-854
Classification Level Classification E-value
Superfamily vWA-like 7.12e-26
Family Integrin A (or I) domain 0.0075
Further Details:      
 
Domain Number 3 Region: 261-458
Classification Level Classification E-value
Superfamily vWA-like 4.3e-21
Family Integrin A (or I) domain 0.0082
Further Details:      
 
Domain Number 4 Region: 882-1087
Classification Level Classification E-value
Superfamily vWA-like 3.11e-20
Family Integrin A (or I) domain 0.0018
Further Details:      
 
Domain Number 5 Region: 460-624
Classification Level Classification E-value
Superfamily vWA-like 6.04e-20
Family Integrin A (or I) domain 0.0055
Further Details:      
 
Domain Number 6 Region: 645-683
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000907
Family EGF-type module 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|188638
Sequence length 1088
Sequence
MKFLAIWSLPINVTLVLLFAASNTDAHRSCHADIAFVVDNSGSIKGEEWEFGHDLTTWKP
VNWLFVLQFIEDLIVSIRKISNDASFGIVDFSNKAELIHEFIDSQRIEDVVDKVRKMRFK
NENTNTTGGLKLARTKLFGQSRFVHTRKKKVIILITDGMATFDVDQLPQELTNIQNMGIL
VLTVGVTNQVENTFLSRLSQNNFFRVDEFSQLSQLVPRIVTPATCEFINTLMTQPSTPKT
TTTAKPTTTTAIPEVIREFTCSSSEHLIFMIDASKNPAHHNYDKQKNFLRNFIDQSNFED
ERLKIFFVPFSEAKQNENIFLNSTNVIATKLAAQKAIDSLPYLGGVNDLASAVRTVRMRI
FDWMKSKDNKVVRDGKFTIILISGNGRPLDTDLATKEFFETKKEGIKVISIGIGNFCNKD
VFYTFASQPWEKNFYFLTSFLDLNQAFAWVLWNAVCSCDNRASNVVFLVGASSLYQVDEF
KKIMTFMRTFVMSFSTEKYNRISLITLSDGHHVLVRLNESNELNNTLEALNSFSPIGETL
MAEAIKSAMKELSLTNELNKNVDRVIVIISAIHPNDLLESVQQASLAKDDGIQIITVGIQ
SRYFKLSKFNLLASYPSANKIYVKTTDMMDNNLAKKLVNFAGNVEDECSSRPCQVGTCID
LINSYSCSCPKGFSGTNCQFKMDNRVDLIFMVDMTTGVKQNGFNQIKDFIMKIISMYQIA
SSMDTRVGLLTYNEKPLIRFHLNKYNSSESLYGAVSMIQYNATKGHDLMKALLEVEKMFT
KENGDRPDVPNVVILIHNGRMISRKGYKSPEIQLSSRIRGDSNLMMSIAVGMDFYKFVLM
NYASYGVNSIMSTAKHSGLIQLAEPTFKTTLKDLNVCAGNPCNRGTCTPFFNSFTCLCPT
YSSGLNCERQCSAVQDIALLLDLSGAADQSTIISFATSFVSGLPIQSNAVRLAAIYYGKH
AKVAFNLNSYNNTRQVLNALAVPHVSGPANTIFALNLAFSDVFKASNGDRKDVSNIVVVV
GHAISKIADNIKNSKYYNDNVKKFVIEITSSSLSAATTESSNSLNVFRAKADALTTTSEK
LLNTICNL
Download sequence
Identical sequences T1FQ74
XP_009019670.1.102002 jgi|Helro1|188638

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]