SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|188701 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|188701
Domain Number 1 Region: 190-276
Classification Level Classification E-value
Superfamily vWA-like 0.0000245
Family Ku70 subunit N-terminal domain 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|188701
Sequence length 408
Sequence
MEFSSPKDEKRKRVGSQQQRANISSSSSSSSAPNPNGNINKDKPNNSSFNSLPSSATTIK
RPPPNTDKLENDFLTDYQFQNIFDFPRKQKEKDSSREKPSTSSSFSSHSESQILLKKNDS
AKENLPSTSHHSTVRKREPTDNPNSSCEDGVADATENVPRRSGSYSLPMSLSFGSNVKKV
SRTVPAINCKEKIIFCIDISKEMFHTTFNDDQPVNTPPFIQYLKKAMHIFMVNKSRINKL
HEYSIILLSKTALWVTDFTSDIFRILDMLKELPESDAVELDVNSIFQTIQKRITMNQESI
DEMKTPAYVYRAILIYARQFHIPAIDLVHNEFFQKSEQFVMDVIYLYNETINDNNSTQIF
KNLCTLDFQGVSYIMGASKPAELYKCFSQMLGHPYQRPIQKDAHLRIN
Download sequence
Identical sequences T1FQ99
XP_009019834.1.102002 jgi|Helro1|188701

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]