SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|188810 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Helro1|188810
Domain Number - Region: 193-228
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00163
Family EGF-type module 0.017
Further Details:      
 
Domain Number - Region: 127-153
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0202
Family EGF-type module 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|188810
Sequence length 326
Sequence
MPKISGLGISNLDIVVSSSSSNTIRVDSKLNMPKISTQIRTSIHNTQSLMAFNPESQPEV
PWFKDSCKQNLGGCSHMCISIYQSSSPLSSSSSSSSSSSSSSSSSSSSSPSPTSPSSSSS
SAAAAAAANVRCYCPAALQLAKDLKTCISRNNIRNGFDQGEHGRNGSILLTRRVNLLSVY
RTYEARFWEAGNSMCPNSTCPSGVECVSISRNSFRCKCPPGMKGLLCLTDELPEKSGASI
GTALISATFAFVIISSLLFAVVFSVRAKRLVQMGHRLDRSAVKMIIFNRGIQQAAPSKGH
KKLVNEKDDGDSFVSQVVISKQESQS
Download sequence
Identical sequences T1FQE0
XP_009020100.1.102002 jgi|Helro1|188810

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]