SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|188890 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|188890
Domain Number 1 Region: 198-265
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000206
Family Ovomucoid domain III-like 0.0091
Further Details:      
 
Weak hits

Sequence:  jgi|Helro1|188890
Domain Number - Region: 302-338
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000121
Family Ovomucoid domain III-like 0.016
Further Details:      
 
Domain Number - Region: 143-192
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00751
Family Ovomucoid domain III-like 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|188890
Sequence length 346
Sequence
MRSFKGKIVFNAALTAKTTNKHLSEFPHRSTVEKLTYAALQGKIVFNVALTAKEILGTCW
NYIDAQTSECFSPVESAVTKRACCRSSSLTRRGWSPKVLSNTEYALYKQVGSRHDCQHCV
VSCRNIQCGLNEVCKEENDKAVCKCSDCADAPRNQICSSGFKTFDSECHRISYLCKNPED
NFNYFNYNGSCKSDCSQVICPSGRHCVYFETQPICILCSTCNIDWGIDGPVCGTDNRTYD
RVCTLNKDSCLRHNGRVKLAYNEPCRASASCDNVKCNDGLSCLVSPDTHMPRCFECYDCH
TPRVSFQDDGPFCATNGKTYQKYCRMVEDACQTKTYIGKSFQRLNQ
Download sequence
Identical sequences T1FQG1
jgi|Helro1|188890 XP_009022711.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]