SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|188910 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|188910
Domain Number 1 Region: 1197-1218,1386-1462,1692-1726,2293-2318
Classification Level Classification E-value
Superfamily Sialidases 0.000000373
Family Sialidases (neuraminidases) 0.023
Further Details:      
 
Domain Number 2 Region: 431-473,736-794,924-1000
Classification Level Classification E-value
Superfamily Sialidases 0.00000235
Family Sialidases (neuraminidases) 0.026
Further Details:      
 
Weak hits

Sequence:  jgi|Helro1|188910
Domain Number - Region: 1506-1538
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00168
Family EGF-type module 0.041
Further Details:      
 
Domain Number - Region: 2177-2202
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00203
Family Integrin beta EGF-like domains 0.092
Further Details:      
 
Domain Number - Region: 1027-1054
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00233
Family EGF-type module 0.054
Further Details:      
 
Domain Number - Region: 60-86
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00977
Family Integrin beta EGF-like domains 0.054
Further Details:      
 
Domain Number - Region: 620-653
Classification Level Classification E-value
Superfamily EGF/Laminin 0.01
Family EGF-type module 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|188910
Sequence length 2385
Sequence
MFENEQSKLTQLNKSLNKRRHPHCNNRSPSTRFRWRQSYVATRGNIWALDKIYVGDDCHW
MCSGHGTCDGDKCICDAGYEEPYCTVVRQLPTRLRDSFQRNNINSGKYINMHLRENLTLP
NKVDSSYTLVLGGEVTDVCGVVVHDKALVFFKASLIQFYNCKDSIRLLMTYDLDLSTATH
VEFSLMFDCHRLPQQSYSYSFADPRPEEHQIIVQFSTNGGIHWNHLHLIKYNDASFQESL
TRFFSLSLPLEARFSSTSIRFWQSINAASSGWMRGAWMIDDLFIGGPTQSTLPSLPSLPL
HSSDGFLPEKVFHEMFENKSSFDDDAEEFDSPSDDLFLFWPSGRIAKYCSHKMNPGLSTS
GSSALVFQEKFSKSSLERRSKIPSKTAEFSQTSELMGSRYLMTNDIFVNDMTVIQFEINV
GCDGDPISWPADQPVRLEYSLDRGRTWNLLIAECSSNHQPLCERDYMIHPSIYSSAVYSY
WTQVVIPLKNLKIYGFVRFRWSQDTSQKNSDSEPTQEDNIINEDAIKSNIDVASYEYIDD
DFVITNRHKTVREKRYIYEPDGMRKKKNIVNSQHKPFPNYKNIRISNNKTPMNVTSPVLS
SSSSSARSWAIDNIYIGTQCVAHCQGRGTCYEASVCDCFHGYEGTSCENPTSKLKHKNYL
REDFDNSKRNFRKKFSVISGASVSDKCSRVLHGTSLNFHQPTERILTTNPLNLTHANVIS
FYLKFDCQSTNNIKSTINIKNLNSNKVYEAIYLQYSLNNGLEWNLIERFDPIYIGGNDVD
NIVMQDDAFIAAPLHRISGQDVIKQWNAPIGPKHLNEDYFQLNYDFPSHVDDEYRTATSV
NSEYSNAEKFSNSDGKADAEAKDDDDDDDDDDAENIYDVEIGGVISGAVTNDMMITASTF
IHFNMTMDCLGENDCFGEISGQLFFLKLKAVRLEYSTDFGKTWRLVKEPCSEADVLTCSN
EVQPTIFYSEFMSTWKRISLILPDSMRFANARFRWVQTNRVGKETDFLKDSGAWALSHVY
IGDECESFCAGHGFCWNASCRCDEGWSGSSCNLPTRQLKSKFVEKFNNYHPFQYNVKHLH
SKSDTNSTTSNSTTRDEHSDGNTVTFVGGVIRTKCSTTKSFHVLHMNGNCTRSVRTVDLN
LTSASVLQFHFAFGCFQKKLNNRNNGFDPLDKKQRPKHLRDHRQHGRHQSHQQARPVHVE
YSLNGASTWNHLLTLQKSLHPHEKLISIQLPDDCKKVGVQFTWWQEMTETRSYGSTNDDN
DVHANNDDDDDDDGSSGDDDDYWRPTWVLDDIVLLSAVEPTFDLYNDVMSDHHNLWNYDR
EERKIVSEDEEEKEDEDQRGNIPQWVSNMASMKFGQFCGLTNSFVSTLSFEDESYVMSVD
LNMATVDDYVLQMRIAVGCHNNENDDDVDGDELPEDVFAVRLEYSTDYGKTWNLVKETCR
QNELECSKAEQPSSYYPSSSWISVAIPLENKLLTNFTRFRWKQVSLSNYNLNMKWAVSDI
YIGPSCVNYCSGQGVCLNRTFCRCYPGHHGDHCQHRQTRSRLKKDLKDDFEIFLPQNGYV
ADVDDADSALNSTEHLKHWSLIQGSTNKPSCLKLLHNAHANRFLDFSSAGLRQAVTRTFD
GRTIGYITFHLLANKNRFEKLNDAEYDGEHGFSAREKHGGWSLEEKSKKLGFEKGMNENC
QPLTNIIRANIILDYSTDGGVSWKLIKSISPLKVSPSLSHYHQYHYVQLPLLKASTLPTS
RNYFPVMFRWWQHPSTSRIFNWGLDNVLIRRTVANPSYLEETFGGDDHHHDEQPTKWETD
NWDFLGRGQRLMNICGSRGYSMAWKKIDSEDNNSQEHNKKLMKMCAGGGGINLGSRQIHG
SSIVTRPLVIQDGHILQFKVNFSRNVIFQQIMLRCARCVECFKASGLTIALEYNIDPEKD
DWQLVNGGCDHNNNINNNNINNNNINNNNINNKYHISDNSIHINSKANHNIIKSKQKNIL
PSSKLKTGNDNNTNGHVKNLDSDDFSEPAEDAPTTNNMQTKCSKTSSNFIPSSLYSECDF
KTWTRVYIRLPRPTFSGNTRFRWRVWRNVSDATSKNEYSDKITKNANKPTSNIENVTNDD
EPYEGSVSKVFDANRKQDCSIGSLKQFKELISKVNNFSNFHKRTPRYARVDSKVYDATKD
GLLWALDEVYVSEGCEHLCHGRGVCRRGECLCDEGYSGTHCGKVTKELLQSFSTNFDANL
SDLHLGWSKIDGGSIGDGCGVLGSGRSLYFNGCCLRQAVTAELDLGRNSSRISFIVAIGR
TDLPWSCNFDIHDKCSVDILLQYTLDKGITWQTVAEIRSRRAAEKLIFDVPVGARRPGAQ
FRWWQPSHKGRGRDQWAIDDVVVSSDSFKLSEANNSKRRRIFGHG
Download sequence
Identical sequences T1FQG9
jgi|Helro1|188910 XP_009022761.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]