SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|189059 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Helro1|189059
Domain Number - Region: 143-172
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00795
Family Merozoite surface protein 1 (MSP-1) 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|189059
Sequence length 212
Sequence
MGLQVKGKRKIICMFTKIDCFLKTDFHMGSEEDLCRVNSSQAATRLRDDKNLYEPTKGGN
ANSAYLALPYIIIPIFKIQYFNKLDLNRKLLNVLDLESMRVEKVLIVLVANLRSMNMNLA
AVAHLLRPPTSVRSERLFSVVSDVNNDHCSKYIACYQIRPKTIKCICTNPAPDWCLQIRL
NSAAAGLGKVKSAIALANECLSSNDAVAIAHI
Download sequence
Identical sequences T1FQL7
XP_009023238.1.102002 jgi|Helro1|189059

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]