SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|189109 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|189109
Domain Number 1 Region: 5-158
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.000000000000142
Family Fucose binding lectin 0.01
Further Details:      
 
Weak hits

Sequence:  jgi|Helro1|189109
Domain Number - Region: 513-549
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00358
Family EGF-type module 0.017
Further Details:      
 
Domain Number - Region: 160-238
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00911
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|189109
Sequence length 671
Sequence
MYLRADYTNVALKKTAYNSNNSSSAQVGVDGDIYNDLLCIAASYNPPWFVVDLLNGYQVK
HVVLYNRRDCTGCDYRLYMFMVGLFNNFDPNVNKTIVKKSYDLCGQWPTTVFTAGQPMRI
DCANEKLFSKFVIIQQWQDSDSLNIVRQFEFAELEVYANADRLSNFKVGLSNNFDPRNKN
SILGNYELCAKWPGIGLYGKQPMKVICTNKTFYSRYVIVQPTTNVDLTFGEMEVYGTENS
TEKFYGCFKTFQTQKTFNESSLEICLSLCKQSDINYATVKMEQDKKTCFCGTPVEPYPSY
SFCSSSCDASGVCTETSIYAVYMAKTPSINWTYMGCYQDRDDKDLVVQTLNLDTMTVETC
TQKCYTRNFLFAGLQYGLCFCGNSFGKYGRAKESDCSGGNLLQKCGGKYFNSLYFLYNTY
GTNKSYSDIYHCSNQSNFTPWLTCESKSCDPGWNGDACDKRDCLVNNGNCGTAHRCYSFK
VGAATLTECVCKSGYMKTYYNDDCISYIYPGAEKCPDNKLVCKKPSEICASMNGSYVCQC
SSGYERINNVCSVPIERQVMIAFVVIAGVFLLANISLIIYICYKSGKWSKSNTKQSPPTP
VKAASSLPPNLSRYHNTNVVATNYNTSIDEANDDADNVDYDYTGPNFNDATWTRDQKIIS
SKRNTMISNNT
Download sequence
Identical sequences T1FQN8
jgi|Helro1|189109 XP_009025344.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]