SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|189175 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|189175
Domain Number 1 Region: 219-424
Classification Level Classification E-value
Superfamily vWA-like 6.38e-48
Family Integrin A (or I) domain 0.00028
Further Details:      
 
Domain Number 2 Region: 423-617
Classification Level Classification E-value
Superfamily vWA-like 1.53e-44
Family Integrin A (or I) domain 0.00048
Further Details:      
 
Domain Number 3 Region: 621-841
Classification Level Classification E-value
Superfamily vWA-like 2.4e-38
Family Integrin A (or I) domain 0.0012
Further Details:      
 
Domain Number 4 Region: 865-1071
Classification Level Classification E-value
Superfamily vWA-like 1.13e-29
Family Integrin A (or I) domain 0.0022
Further Details:      
 
Domain Number 5 Region: 1094-1300
Classification Level Classification E-value
Superfamily vWA-like 2.78e-29
Family Integrin A (or I) domain 0.0023
Further Details:      
 
Domain Number 6 Region: 31-219
Classification Level Classification E-value
Superfamily vWA-like 2.5e-24
Family Integrin A (or I) domain 0.006
Further Details:      
 
Weak hits

Sequence:  jgi|Helro1|189175
Domain Number - Region: 841-874
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0753
Family EGF-type module 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|189175
Sequence length 1300
Sequence
MPKEKLFSTFLTVSLLVSVCVGQNVLNKEDCEGEADVVFLVDASSSTTPSDFYNSLNFVR
DIVNNWLYVSPDSTHVGLSTISSTGKSEIFLTDYTDSNFLSSAIIGKPVFRGGIGNLKSS
LQLVSDEVLRTNNGMRSWVAKVIILVVSDTLILQNDYFRSDLNRLALDLRSSGIMILAMV
YGNSQDQLKVNSLLDEILPYPTSNYKYFFRNGSFAGPDMMGSIQQLCKEIPACSGQADIV
FLMDSTGTIYPSDWEADVKFVSSVVENMYISSQAVRVSVVRFNIEPTRFFCLNNYNNRYE
IVEKVNKDVVYNNGGGTNTALALQFVVEQVFTASCGSRPDVPKIVIIITDGTSNIDQVKT
IPTAKMLKDKGIQIFAIGVGDIDEAGRNELIGIASSPPSSYFFKVNEFADLKFLKNTLVK
RTCKLPPSSCSSLLDLIFILDTSGSIFLNDYNKEKLFIIDLIRKMDVELGFTKIGFMTFD
TQPNEIFSLRTSSNTQDLINLVQSAPYTGGVTNTNLALKFLRETAFSEERGARRGVAKVA
LLMTDGAANNFTAATQEAVLTRNAGIDIISLGIGSMINKNELQTMSSYPSEKNTIFVEYY
DLLTTASDPLLKLICNQIDNCLSNPCLNGGTCQSGLNNFYCKCPGNFTGPKCEKRCTNYV
DLVVALDCSSSLLYSDYIQAQLFTRNLIISLNLNVGSRVGALIFSDKAEIQFQLKTYTDT
KSALNAVNFRFVEGSTNTAEAIRVARMEMFQPYNGDRLNAPNVLLLITDGQSNVQNRTLD
ETRLAMNAGITILTIGIGSYVNVDELSRITSFPISANMFVIRDYFQLTDIVTPLSNVLCR
DVDACASNPCQNRGTCRSTINSFSCDCPTGFIGDTCNLPCVNQIDVAFLIDVSQDMQPEI
YKNLTDFIKGSIRQMDVQSGKTRVAIVEYAEHAKVIIPLSSSTTIYDYMFLTDQLSFGVE
KRMISSGLNLAINNVFTASSGDRADATNIAVIVTRGLPHASDTDVMSVAVKAHVAGISTI
VVVVGPDFILGRNYLQMSNLASEPIAYNYFSVLTFGRLPAQASLVSASMCNNVSMCSSQT
CFNGGKCAEGLNTFTCSCSGTFSGSRCEKTCNSLDLDVVFLADVSGSLELGGFDIATSIM
KRITEGLNFRYGRTRMAYVTFANDPTTVFNFNKYLGVDNSQIFVSALNIYQVLEWTNIAK
ALRHVNSNVLRPEVGHRMGVRTAVVVISDFKPTVDILATAPAANELKAAAEIFGVGLLET
PDEETMRMVASSPEYDYTYKVSSTSSVASAADMILEKLCQ
Download sequence
Identical sequences T1FQR2
XP_009025465.1.102002 jgi|Helro1|189175

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]