SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|189200 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|189200
Domain Number 1 Region: 26-247
Classification Level Classification E-value
Superfamily vWA-like 8.9e-45
Family Integrin A (or I) domain 0.0000548
Further Details:      
 
Domain Number 2 Region: 475-516
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000114
Family Integrin beta EGF-like domains 0.0033
Further Details:      
 
Domain Number 3 Region: 263-347
Classification Level Classification E-value
Superfamily Integrin domains 0.0000837
Family Integrin domains 0.0057
Further Details:      
 
Weak hits

Sequence:  jgi|Helro1|189200
Domain Number - Region: 447-472
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000865
Family Integrin beta EGF-like domains 0.018
Further Details:      
 
Domain Number - Region: 353-380
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00103
Family Integrin beta EGF-like domains 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|189200
Sequence length 630
Sequence
MSQLKQGSVCRFAYEITHLEVEFESARNHPLEIYFLVDATSTMQPLREHILQVIDELVSN
LKKITLKVKIGLGLFAEKRIIPFAEYSNNTETSYNFKNQVNLTTDFDLFKKKVKEFEKIR
NNDAPEDWLSAFVQIVTCKEIIGWSDPARKLVILFTDEAFHHAGDGKLAGIVEVNDLSCH
LDANGYYTHDKIQDYPSVSQVKYLVELKKIHLFMFINDWKDRIVNIYKELKEILPYSLFF
PFKENFNESDPFKFISDNYKSIQKKVEFVSNDVPRDDLHWVIESQCPNEAEFTSKSYCPE
VHPDDKAKFKFQISTSSCDKRTILFDLPDHNEKIQVDIEGICQCSCESFRKSSICNMHGD
AECGSCQCHEGYYGDKCQCFTERVVKVNSNFSFNKNVCQPLSALQLVSVTTMIVNKYRDE
CATVGSNNLPRTHSNDDRRCKINLVYYSDKGTCHCGKCQCQPGFSGSACDCPTSNKTCLA
SNGDLCNGVGECNCGVCQCAKDRPFIGDTCEECPTCSDDVCQEHEFCASCFFEPDDHICH
SECSTNIHPVNQLPECVSELMIIGSVVGGVAMIGVIMLVVWKVVVTVHDNKEYKKFEMER
KNAKWALNVSPLYRDAVSRYRNPIYGLNKD
Download sequence
Identical sequences T1FQS1
jgi|Helro1|189200 XP_009025515.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]