SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|189281 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|189281
Domain Number 1 Region: 283-413,441-457
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000279
Family Growth factor receptor domain 0.0023
Further Details:      
 
Domain Number 2 Region: 205-316
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000157
Family Growth factor receptor domain 0.0013
Further Details:      
 
Domain Number 3 Region: 414-452
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000439
Family EGF-type module 0.014
Further Details:      
 
Weak hits

Sequence:  jgi|Helro1|189281
Domain Number - Region: 174-207
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0402
Family EGF-type module 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|189281
Sequence length 551
Sequence
MLCKQNLIALFIISFSSLHEFTEAVKVFKNTSEYCDICRHISEKFEEGIKNTARSNFGGG
NTNWEERSLGKYGQSETRLVEILESCCDGLDDKTAKSRCEGLLEEHDEWIEEWWRTVYHQ
EEDDDDDDDKPKKNKQNETKKNLYSDFCVQKVAACCEKGFYGSDCKACPGGPQDPCNGNG
ICTGSGYKDGEGTCECSSGYEGEECDRCKEGFVSQDGRKCLGCHKSCKSTCTTPNDPKTC
NECKNGWKKDEDGVLGCVDVNECLDPDRCPSHTYCRNEEGNSACLDCDKSCSGCFGPLDS
DCKQCADLHYMHESTCLPCHKSCKNSCTDGTSKTCDSCNDGWEHNGEECIDKDECEMGQD
VHKCDPIVSYCKNKDGSFKCKSCHSLCVGCRGPKPHQCKECKKGYQFNEDHECVDMNECE
QEVPVCQEEHEQCVNRVGSFVCECEDGYVRRRGGPCQKKHIIITDDEPKRPTKEGKPAEA
EKKGSAKIPTPRPSFEDFKSVTPGPNGYTEEDLKKLGEPLQGKLSDEKIVIEGKSKMNER
MGGEDKEKTEL
Download sequence
Identical sequences T1FQX0
jgi|Helro1|189281 XP_009025683.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]