SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|189432 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|189432
Domain Number 1 Region: 301-550
Classification Level Classification E-value
Superfamily Kelch motif 1.12e-44
Family Kelch motif 0.00034
Further Details:      
 
Weak hits

Sequence:  jgi|Helro1|189432
Domain Number - Region: 18-86
Classification Level Classification E-value
Superfamily POZ domain 0.0146
Family BTB/POZ domain 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|189432
Sequence length 624
Sequence
MLETADAQTEKVDSSAGQQTIILISQKGGRYEIDKKTFSQISGYYRSLVNSGMRDAASNE
LDLKELSNRCLAEVNPGIYYKNSANHATTGFNKLICSENFFAEIKECYSQLKIKGKTLKL
LKNIEEGLKGASFLQINSMIDHYSALLLKHLNVQTCLRILLFANKYSLDKALETVLDYWL
NNFKFVAGGSTLLPLNVIDRLAKADVVNSDSEFDIFSYIINCLSVDNSMRCHAEKLLSEV
RYHLMTASSKQICRDRLRVLNVNHININQDYANSSRSVGVLLSLGVASEKRVPDFFHSLS
VYDLVSMTCKKRRSQGCVSRSLVKFRSCRMPGPPLEWLRYQACILNDSLYLAGKLNEEAF
FSNQVYVYDLIKSTWRQCCNMHAARALFYFDKIAGHLYAVSGQFTKIHRTHVVEKYFPDK
DKWYLLASLPVAVSSLTGCVFRGMMYVSGGDDGARFLTNVYRYDPYGGRWECRTPLLTAR
CCHIMTYVGNKLIVLGGKVVDQLHRREYAMDGEIYEFETDQWTSVLRLIKPVVYSPSVLV
NSCLYIFKNHTSLFVKQNRNVIQKINLTKFLNEGETSALTVEKRMDVDNNDDDVDEKEEG
ECQLYEYCIENFGSPMTHLCLYFK
Download sequence
Identical sequences T1FR19
jgi|Helro1|189432 XP_009027610.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]