SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|189468 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|189468
Domain Number 1 Region: 43-83
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000552
Family EGF-type module 0.015
Further Details:      
 
Domain Number 2 Region: 4-40
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000948
Family EGF-type module 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|189468
Sequence length 420
Sequence
MEYCTHNPGICLNGGTCVSSMPDIFCLCPANYEGEHCEKLKIINSCLLSPCLHSGTCVRM
PNSSKYTCTCSARYTGGHCETEIPTNPCSADDFQCLCSLNVTFCKYTTKVVTPLTVDRLS
NITTKTTATISAVNPTTPSNATSTSPTTVSRNQTTTVNSTDDENNKLPRPPISDELRSIL
VISSVAIVSLILIVTTLVIACCCRRRRQQRRQQSKILNNFGANNQTISSRSTSSSFNNKT
KNCQVVIKNDITNSRRNINLSTENEVLDKLTNKHQNIKNERRCNECLAQAIQVEKKAKEI
SKHRLWKPSLDLNYTYQCSSCGLVDLTPNSIYENSTAMKDLQTEADHPTKAKSVLVTIEP
QLRSPKRKDATSIAKLSVLESSSGDFNYTSSISCDRGIMTADEDNIFNEYNDDRIRATCV
Download sequence
Identical sequences T1FR30
jgi|Helro1|189468 XP_009027699.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]